SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.15g248500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.15g248500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.15g248500

Feature Type:gene_model
Chromosome:Gm15
Start:47403421
stop:47403801
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.15g248500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00500.1AT acetyl-CoA carboxylase carboxyl transferase subunit beta JGI N/AIEA
GO:0006629GO-bp lipid metabolic process EnsemblGenomesN/AIEA
GO:0006631GO-bp fatty acid metabolic process EnsemblGenomesN/AIEA
GO:0006633GO-bp fatty acid biosynthetic process EnsemblGenomesN/AIEA
GO:2001295GO-bp malonyl-CoA biosynthetic process EnsemblGenomesN/AIEA
GO:0009317GO-cc acetyl-CoA carboxylase complex EnsemblGenomesN/AIEA
GO:0009507GO-cc chloroplast EnsemblGenomesN/AIEA
GO:0009536GO-cc plastid EnsemblGenomesN/AIEA
GO:0009570GO-cc chloroplast stroma EnsemblGenomesN/AIEA
GO:0000166GO-mf nucleotide binding EnsemblGenomesN/AIEA
GO:0003989GO-mf acetyl-CoA carboxylase activity EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0016874GO-mf ligase activity EnsemblGenomesN/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
PWY-7388SoyCyc9 octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) Plant Metabolic Network ISS
GN7V-54808SoyCyc9-rxn acetyl-CoA carboxylase Plant Metabolic Network ISS

Expression Patterns of Glyma.15g248500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.15g248500 not represented in the dataset
Glyma.15g248500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.15g248500 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma15g39765 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.15g248500
>Glyma.15g248500.1 sequence-type=CDS polypeptide=Glyma.15g248500.1.p locus=Glyma.15g248500 ID=Glyma.15g248500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTTGTTTAATAGGAAGTTAGAATACAGGTGTGAATTAAGTAAATCAATGGATAGTCTTGGTCCTATTGAAAATACCAGTCTAAGGGAAGACCCTAAAATTTTAACCGATATAGAAAAAAAAATTCACAAGGATTTGGATTATTTAGAAATGGAAGGTTTTTTTTCTAGCGATCTGAATACTGTTTCTAAGAATGATGATGATCATTACATGTATGAGACTCAATTTAGTTTTAACAATAATATTACTAGTTTCATTGATAGTTGCATTGAGAGTTTCAATTTAGGTGATATTGACAAATACAATGATATTTATTTTTATAGTTACATTTTTTTAAGGGCAGAAATTGTAGTGAAAGTGATAATTCTAGTACTAGTATAA
Predicted protein sequences of Glyma.15g248500
>Glyma.15g248500.1.p sequence-type=predicted peptide transcript=Glyma.15g248500.1 locus=Glyma.15g248500 ID=Glyma.15g248500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLFNRKLEYRCELSKSMDSLGPIENTSLREDPKILTDIEKKIHKDLDYLEMEGFFSSDLNTVSKNDDDHYMYETQFSFNNNITSFIDSCIESFNLGDIDKYNDIYFYSYIFLRAEIVVKVIILVLV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo