SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.15g221000

Feature Type:gene_model
Chromosome:Gm15
Start:39932914
stop:39934065
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.15g221000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G04920.1AT EAP30/Vps36 family protein JGI N/AIEA
GO:0032509GO-bp endosome transport via multivesicular body sorting pathway EnsemblGenomesN/AIEA
GO:0043328GO-bp protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway EnsemblGenomesN/AIEA
GO:0000814GO-cc ESCRT II complex EnsemblGenomesN/AIEA
GO:0031902GO-cc late endosome membrane EnsemblGenomesN/AIEA
GO:0043130GO-mf ubiquitin binding EnsemblGenomesN/AIEA
PTHR13128Panther FAMILY NOT NAMED JGI N/AIEA
PTHR13128:SF5Panther JGI N/AIEA
PF04157PFAM EAP30/Vps36 family JGI N/AIEA

Expression Patterns of Glyma.15g221000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.15g221000 not represented in the dataset
Glyma.15g221000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.15g221000 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma15g34653 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.15g221000
>Glyma.15g221000.1 sequence-type=CDS polypeptide=Glyma.15g221000.1.p locus=Glyma.15g221000 ID=Glyma.15g221000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTGATGCTAGCAGAGAAAATGAGGCTAAAACTTTTGTCTGGCTCAAATTCTCAAACCAATGCGACTAATGATGAGGAGATGGGTTCAAAGGAAGAGATGCAAGATTGGTTATTGAGTGTTGGTATTATATCCCCTGTTACCAAAGAGTCTGTGGGTGCTTTGTATCATCAACAACTTTCTCGTCAGTTGGCAGATTTTGTTAAAGTTCCACTTGAGAAAGCTGGGGGAATTATCAATCTTATTGATATATATTGTCTCTTCAATCATGCTTGTGGCATAGAATTGATCTCACCTGATGATTTGTTGCAAGCATCTTCTCTGTGGGAGAAGTTTGATGTGTATGTTTTACATTATCTTCTATTTAAATTACTTCTGTTACTGTGA
Predicted protein sequences of Glyma.15g221000
>Glyma.15g221000.1.p sequence-type=predicted peptide transcript=Glyma.15g221000.1 locus=Glyma.15g221000 ID=Glyma.15g221000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVMLAEKMRLKLLSGSNSQTNATNDEEMGSKEEMQDWLLSVGIISPVTKESVGALYHQQLSRQLADFVKVPLEKAGGIINLIDIYCLFNHACGIELISPDDLLQASSLWEKFDVYVLHYLLFKLLLLL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo