Glyma.15g202300

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.15g202300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.15g202300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.15g202300

Feature Type:	gene_model
Chromosome:	Gm15
Start:	25414464
stop:	25417891
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.15g202300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G35100.1	AT	Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein	JGI	N/A	IEA
GO:0000413	GO-bp	protein peptidyl-prolyl isomerization	EnsemblGenomes	N/A	IEA
GO:0006457	GO-bp	protein folding	JGI	N/A	IEA
GO:0003755	GO-mf	peptidyl-prolyl cis-trans isomerase activity	EnsemblGenomes	N/A	IEA
GO:0003755	GO-mf	peptidyl-prolyl cis-trans isomerase activity	JGI	N/A	IEA
GO:0016853	GO-mf	isomerase activity	EnsemblGenomes	N/A	IEA
KOG0880	KOG	Peptidyl-prolyl cis-trans isomerase	JGI	N/A	IEA
PTHR11071	Panther	PEPTIDYL-PROLYL CIS-TRANS ISOMERASE	JGI	N/A	IEA
PTHR11071:SF11	Panther	PEPTIDYL-PROLYL CIS-TRANS ISOMERASE	JGI	N/A	IEA
PF00160	PFAM	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD	JGI	N/A	IEA

Proteins Associated with Glyma.15g202300

Locus	Gene Symbol	Protein Name
	CYP55	peptidyl-prolyl cis-trans isomerase CYP55

Expression Patterns of Glyma.15g202300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.15g202300 not represented in the dataset	Glyma.15g202300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.15g202300 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma15g24560	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.15g202300

Limit To All Plant Sequences

>Glyma.15g202300.1 sequence-type=CDS polypeptide=Glyma.15g202300.1.p locus=Glyma.15g202300 ID=Glyma.15g202300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGTTCTCTCTCCCTCCACCACCACCCTCTCTCTCTCTCCACTTCACGCGCCGCTCCCTCCTCCTCCTCTCCACCACCACCACCCTCTCTCTCCCATCCACACCTCCACCTACTCCCATTCCCACCACCCCCACAGTCACCGACCGCGTCTTCATGGACTTTAGCCTCTGCCCCAACAACTTCCTCCCCGACCGCGCCGACGCCCTCTCCCCTCTCTGCTCCGACTCCAACCTATTGGGTCGCGTCGTATTGGGCCTCTACGGCAACCTCGTCCCCCTCACCGTCTCGAACTTCAAGTCCATGTGTCTGGGCGGCCTCAACGCCACGTCATCCTCGTACAAGAATACGCTCGTCCACAAGGTGTTCCCCGGCCAGTACTTCCTCGCCGGGCGCCAGGGCCGCCCCGACAAGGGCGAGGTCCGCCCGCCGCACGACCTGCCGCGCAACACGGAGACGGTCGACGCTAAGGCGTTCGCCCTCACGCACTCCCGGCCCGGCGTTGTTTCGCTCTCGCTCTCCGAAAACGACGACGACGACGAGATTAAGCTCGATCCTGGGTACCGGAATGTAGAATTCTTGATCACCACTGGTCCCGGGCCTTGCCCCCAGCTCGATAACAAGAACATTGTCTTTGGAACGGTGCTCGAAGGATTGGATGTCATCACAGCTATAGCTTCCATTCCCACATACCAACCATCTGAGCGAATTCGCCAGTTTAACGACTTGGCTCGATTTTTTGGAGATGAAAGGGCTCAGAATGCACGTAACATATGGAACAGGCCTCTTACGAGTGTTTATATTAGTGATTGTGGGGAGCTGAAAGTGACAAAGCCTTCCCTCACGCCTTCTTTGCCATAA

Predicted protein sequences of Glyma.15g202300

Limit To All Plant Sequences

>Glyma.15g202300.1.p sequence-type=predicted peptide transcript=Glyma.15g202300.1 locus=Glyma.15g202300 ID=Glyma.15g202300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAFSLPPPPPSLSLHFTRRSLLLLSTTTTLSLPSTPPPTPIPTTPTVTDRVFMDFSLCPNNFLPDRADALSPLCSDSNLLGRVVLGLYGNLVPLTVSNFKSMCLGGLNATSSSYKNTLVHKVFPGQYFLAGRQGRPDKGEVRPPHDLPRNTETVDAKAFALTHSRPGVVSLSLSENDDDDEIKLDPGYRNVEFLITTGPGPCPQLDNKNIVFGTVLEGLDVITAIASIPTYQPSERIRQFNDLARFFGDERAQNARNIWNRPLTSVYISDCGELKVTKPSLTPSLP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain