SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.15g180400

Feature Type:gene_model
Chromosome:Gm15
Start:17396983
stop:17398099
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.15g180400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G09640.1AT ascorbate peroxidase 2 JGI N/AIEA
GO:0000302GO-bp response to reactive oxygen species EnsemblGenomesN/AIEA
GO:0006979GO-bp response to oxidative stress EnsemblGenomesN/AIEA
GO:0006979GO-bp response to oxidative stress JGI N/AIEA
GO:0034599GO-bp cellular response to oxidative stress EnsemblGenomesN/AIEA
GO:0042744GO-bp hydrogen peroxide catabolic process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0098869GO-bp cellular oxidant detoxification EnsemblGenomesN/AIEA
GO:0009507GO-cc chloroplast EnsemblGenomesN/AIEA
GO:0004130GO-mf cytochrome-c peroxidase activity EnsemblGenomesN/AIEA
GO:0004601GO-mf peroxidase activity EnsemblGenomesN/AIEA
GO:0004601GO-mf peroxidase activity JGI N/AIEA
GO:0016688GO-mf L-ascorbate peroxidase activity EnsemblGenomesN/AIEA
GO:0020037GO-mf heme binding EnsemblGenomesN/AIEA
GO:0020037GO-mf heme binding JGI N/AIEA
PF00141PFAM Peroxidase JGI N/AIEA
PWY-2261SoyCyc9 ascorbate glutathione cycle Plant Metabolic Network ISS
PWY-6959SoyCyc9 L-ascorbate degradation V Plant Metabolic Network ISS
GN7V-66646SoyCyc9-rxn L-ascorbate peroxidase Plant Metabolic Network ISS

Expression Patterns of Glyma.15g180400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.15g180400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma15g19940 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.15g180400
>Glyma.15g180400.1 sequence-type=CDS polypeptide=Glyma.15g180400.1.p locus=Glyma.15g180400 ID=Glyma.15g180400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCTGGTGCGCATGGACCCATCGGACATCGCTATTAGGCTTTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTACGCCGATTTCTACCCGTTGGCTAGCGTTGTTGCCGTTGAGGTCACGGGTGGACCTGAAGTTCCATTCCACCCTAGAAGAGAGCCTGGGTGTTGCTGGATGGAGAGTTTTGCCCCAAAAAATTTCAATTTTTTAGAACAAGCACATTCACGGGTACTTGAGATTCAACATTTTCCCCCCTAA
Predicted protein sequences of Glyma.15g180400
>Glyma.15g180400.1.p sequence-type=predicted peptide transcript=Glyma.15g180400.1 locus=Glyma.15g180400 ID=Glyma.15g180400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLVRMDPSDIAIRLLEPLKAEFPILSYADFYPLASVVAVEVTGGPEVPFHPRREPGCCWMESFAPKNFNFLEQAHSRVLEIQHFPP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo