SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.15g179000

Feature Type:gene_model
Chromosome:Gm15
Start:17131256
stop:17132965
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.15g179000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G62710.1AT beta vacuolar processing enzyme JGI N/AIEA
GO:0006508GO-bp proteolysis EnsemblGenomesN/AIEA
GO:0006508GO-bp proteolysis JGI N/AIEA
GO:0006624GO-bp vacuolar protein processing EnsemblGenomesN/AIEA
GO:0051603GO-bp proteolysis involved in cellular protein catabolic process EnsemblGenomesN/AIEA
GO:0005773GO-cc vacuole EnsemblGenomesN/AIEA
GO:0004197GO-mf cysteine-type endopeptidase activity EnsemblGenomesN/AIEA
GO:0004197GO-mf cysteine-type endopeptidase activity JGI N/AIEA
GO:0008233GO-mf peptidase activity EnsemblGenomesN/AIEA
PTHR12000Panther HEMOGLOBINASE FAMILY MEMBER JGI N/AIEA
PTHR12000:SF2Panther JGI N/AIEA
PF01650PFAM Peptidase C13 family JGI N/AIEA

Expression Patterns of Glyma.15g179000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.15g179000 not represented in the dataset
Glyma.15g179000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.15g179000 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma15g19771 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.15g179000
>Glyma.15g179000.1 sequence-type=CDS polypeptide=Glyma.15g179000.1.p locus=Glyma.15g179000 ID=Glyma.15g179000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTGGTGCCCATTAGAGTGCACGGTGCAGCCGCGAGGTCGAACCGGAAGGAGTGGGACTTAGTCATAAAGTTACTGACTGAACTGATGGATGCTGACTCGGATGAAGTGGGAACACGATGGGCGATTCTCATGGTTGGTTCAAACGGCTATGGAAACTACAGGCATCAAGTAAATGTGTGCCAAGCGTACCAGTTGCTGATAAAAGGTGGACTAAAAGAAGAGAACATAGTGGTGTTTATGTACAATGACATAGCTTCCAACCAGTCGAATCCTAGACATGGAGTCATCATCAACCACCCAGAGGGAGAATATCTGTATGCTGGTGTTCCTAAGCACACAGACGCTGCTAGTGAATTATACAATACCCACGACCTCACGCTCGTGTCTTAA
Predicted protein sequences of Glyma.15g179000
>Glyma.15g179000.1.p sequence-type=predicted peptide transcript=Glyma.15g179000.1 locus=Glyma.15g179000 ID=Glyma.15g179000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVVPIRVHGAAARSNRKEWDLVIKLLTELMDADSDEVGTRWAILMVGSNGYGNYRHQVNVCQAYQLLIKGGLKEENIVVFMYNDIASNQSNPRHGVIINHPEGEYLYAGVPKHTDAASELYNTHDLTLVS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo