|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G15000.1 | AT | Ribosomal L27e protein family | JGI | N/A | IEA |
| GO:0006412 | GO-bp | translation | EnsemblGenomes | N/A | IEA |
| GO:0006412 | GO-bp | translation | JGI | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | EnsemblGenomes | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | JGI | N/A | IEA |
| GO:0005840 | GO-cc | ribosome | EnsemblGenomes | N/A | IEA |
| GO:0005840 | GO-cc | ribosome | JGI | N/A | IEA |
| GO:0022625 | GO-cc | cytosolic large ribosomal subunit | EnsemblGenomes | N/A | IEA |
| GO:0003735 | GO-mf | structural constituent of ribosome | EnsemblGenomes | N/A | IEA |
| GO:0003735 | GO-mf | structural constituent of ribosome | JGI | N/A | IEA |
| KOG3418 | KOG | 60S ribosomal protein L27 | JGI | N/A | IEA |
| PTHR10497 | Panther | 60S RIBOSOMAL PROTEIN L27 | JGI | N/A | IEA |
| PF00467 | PFAM | KOW motif | JGI | N/A | IEA |
| PF01777 | PFAM | Ribosomal L27e protein family | JGI | N/A | IEA |
|
Glyma.15g158400 not represented in the dataset |
Glyma.15g158400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.09g052100 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma15g17010 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.15g158400.1 sequence-type=CDS polypeptide=Glyma.15g158400.1.p locus=Glyma.15g158400 ID=Glyma.15g158400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGTGAAGTTTCTGAAACCAAACAAAGCCGTCATCGTCCTTCAGGGACGCTACGCCGGCAAAAAAGCCGTGATAGTGCGAACCTTCGATGAAGGCACGCGCGAGCGCCCCTACGGGCACTGCTTGGTGGCAGGGATAAAGAAGTACCCTGCGAAGGTGATCAAGAAGGATTCGGCCAAGAAGACGGCCAAGAAGTCGCGTGTGAAGGCGTTCGTGAAGCTCGTGAACTACCAGCACCTCATGCCCACGCGCTACACGCTCGATGTCGATTTGAAGGACGCGGTTACCCCCGACGTGCTCCAAGCCAAGGATAAGAAGGTTACTGCTCTCAAGGAGACCAAGAAGCGCCTCGAGGAGAGGTTCAAGACTGGGAAGAATCGGTGGTTCTTCACCAAGCTCAGGTTCTGA
>Glyma.15g158400.1.p sequence-type=predicted peptide transcript=Glyma.15g158400.1 locus=Glyma.15g158400 ID=Glyma.15g158400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MVKFLKPNKAVIVLQGRYAGKKAVIVRTFDEGTRERPYGHCLVAGIKKYPAKVIKKDSAKKTAKKSRVKAFVKLVNYQHLMPTRYTLDVDLKDAVTPDVLQAKDKKVTALKETKKRLEERFKTGKNRWFFTKLRF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||