Glyma.15g142700

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.15g142700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.15g142700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.15g142700

Feature Type:	gene_model
Chromosome:	Gm15
Start:	11697903
stop:	11700444
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.15g142700

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G16980.1	AT	RNA polymerases M/15 Kd subunit	JGI	N/A	IEA
GO:0001193	GO-bp	maintenance of transcriptional fidelity during DNA-templated transcription elongation from RNA polymerase II promoter	EnsemblGenomes	N/A	IEA
GO:0006283	GO-bp	transcription-coupled nucleotide-excision repair	EnsemblGenomes	N/A	IEA
GO:0006351	GO-bp	transcription, DNA-templated	EnsemblGenomes	N/A	IEA
GO:0006351	GO-bp	transcription, DNA-templated	JGI	N/A	IEA
GO:0006367	GO-bp	transcription initiation from RNA polymerase II promoter	EnsemblGenomes	N/A	IEA
GO:0006379	GO-bp	mRNA cleavage	EnsemblGenomes	N/A	IEA
GO:0005634	GO-cc	nucleus	EnsemblGenomes	N/A	IEA
GO:0005665	GO-cc	DNA-directed RNA polymerase II, core complex	EnsemblGenomes	N/A	IEA
GO:0005730	GO-cc	nucleolus	EnsemblGenomes	N/A	IEA
GO:0003676	GO-mf	nucleic acid binding	EnsemblGenomes	N/A	IEA
GO:0003676	GO-mf	nucleic acid binding	JGI	N/A	IEA
GO:0003677	GO-mf	DNA binding	JGI	N/A	IEA
GO:0003899	GO-mf	DNA-directed 5'-3' RNA polymerase activity	EnsemblGenomes	N/A	IEA
GO:0003899	GO-mf	DNA-directed RNA polymerase activity	JGI	N/A	IEA
GO:0008270	GO-mf	zinc ion binding	EnsemblGenomes	N/A	IEA
GO:0008270	GO-mf	zinc ion binding	JGI	N/A	IEA
GO:0046872	GO-mf	metal ion binding	EnsemblGenomes	N/A	IEA
KOG2691	KOG	RNA polymerase II subunit 9	JGI	N/A	IEA
PTHR11239	Panther	DNA-DIRECTED RNA POLYMERASE	JGI	N/A	IEA
PF01096	PFAM	Transcription factor S-II (TFIIS)	JGI	N/A	IEA
PF02150	PFAM	RNA polymerases M/15 Kd subunit	JGI	N/A	IEA

Expression Patterns of Glyma.15g142700

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.15g142700 not represented in the dataset	Glyma.15g142700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.15g142700

Paralog	Evidence	Comments
Glyma.09g037400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.15g142700 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma15g15250	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.15g142700

Limit To All Plant Sequences

>Glyma.15g142700.1 sequence-type=CDS polypeptide=Glyma.15g142700.1.p locus=Glyma.15g142700 ID=Glyma.15g142700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAGTGCCATGAAATTTTGCCGTGAATGCAATAACATTTTGTACCCTAAGGAAGACAGAGAACAGAAGGTTCTTCTCTTCGCTTGCCGCAACTGCGACCATCAGGAGGTTGCTGATAACTTCTGTGTGTATAGGAATGAGATACAGCACCCTGTAGGAGAGCGCACTCAGGTGTTGCAGGATGTAGCTGCAGATCCAACGCTTCCTCGAACCAAGTCTGTTCGCTGCACTCAATGCAATCATGGTGAAGCTGTCTTTTTCCAGGCAACTGCTAGAGGGGAAGAAGGAATGACACTTTTTTTCGTTTGCTGCAACCCAAACTGTGGACACCGATGGAGAGACTGA

Predicted protein sequences of Glyma.15g142700

Limit To All Plant Sequences

>Glyma.15g142700.1.p sequence-type=predicted peptide transcript=Glyma.15g142700.1 locus=Glyma.15g142700 ID=Glyma.15g142700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSAMKFCRECNNILYPKEDREQKVLLFACRNCDHQEVADNFCVYRNEIQHPVGERTQVLQDVAADPTLPRTKSVRCTQCNHGEAVFFQATARGEEGMTLFFVCCNPNCGHRWRD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain