|
A previous version of this gene model can be found here:
|
|
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma15g08260 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.15g076100.1 sequence-type=CDS polypeptide=Glyma.15g076100.1.p locus=Glyma.15g076100 ID=Glyma.15g076100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCAAGAGGGCCAAAAACCAAAAGATCCCACACACACCATGCAATGGTTGCTATTCGTACGTAGCCATATAGGCCAAAACTTGTTAAATCACTTCGCCCTATCTTCTCCCTTTCCTTTCAATAATACAGATGCACGCTTCGCTTCACCAACGAATCGTCCCCCACACCCCTCCTCATCTTGTCCACGATAA
>Glyma.15g076100.1.p sequence-type=predicted peptide transcript=Glyma.15g076100.1 locus=Glyma.15g076100 ID=Glyma.15g076100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MQEGQKPKDPTHTMQWLLFVRSHIGQNLLNHFALSSPFPFNNTDARFASPTNRPPHPSSSCPR*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||