Glyma.15g010700

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.15g010700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.15g010700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.15g010700

Feature Type:	gene_model
Chromosome:	Gm15
Start:	813964
stop:	814206
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.15g010700

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G15660.1	AT	glutaredoxin 4	JGI	N/A	IEA
GO:0022900	GO-bp	electron transport chain	EnsemblGenomes	N/A	IEA
GO:0045454	GO-bp	cell redox homeostasis	EnsemblGenomes	N/A	IEA
GO:0045454	GO-bp	cell redox homeostasis	JGI	N/A	IEA
GO:0055114	GO-bp	oxidation-reduction process	EnsemblGenomes	N/A	IEA
GO:0005623	GO-cc	cell	EnsemblGenomes	N/A	IEA
GO:0009055	GO-mf	electron transfer activity	EnsemblGenomes	N/A	IEA
GO:0009055	GO-mf	electron carrier activity	JGI	N/A	IEA
GO:0015035	GO-mf	protein disulfide oxidoreductase activity	EnsemblGenomes	N/A	IEA
GO:0015035	GO-mf	protein disulfide oxidoreductase activity	JGI	N/A	IEA
PTHR10293	Panther	GLUTAREDOXIN-RELATED PROTEIN	JGI	N/A	IEA
PF00462	PFAM	Glutaredoxin	JGI	N/A	IEA
PWY-2261	SoyCyc9	ascorbate glutathione cycle	Plant Metabolic Network		ISS
GN7V-65850	SoyCyc9-rxn	glutathione dehydrogenase (ascorbate)	Plant Metabolic Network		ISS

Expression Patterns of Glyma.15g010700

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.15g010700 not represented in the dataset	Glyma.15g010700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.15g010700 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma15g01341	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.15g010700

Limit To All Plant Sequences

>Glyma.15g010700.1 sequence-type=CDS polypeptide=Glyma.15g010700.1.p locus=Glyma.15g010700 ID=Glyma.15g010700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTCTTACTGTTCTCACGTGTTCTTTCTCTACAGTAACTGGCCAACATTTCCACAAGTTTTCATTAAGGGGGAGTTTATTGGTGGATCAGATATTGTTCTTAATATGCATCAGACGGGTGAATTGAAGGAAAAGCTTAAAGATATTATGTCCAAGCAGTAA

Predicted protein sequences of Glyma.15g010700

Limit To All Plant Sequences

>Glyma.15g010700.1.p sequence-type=predicted peptide transcript=Glyma.15g010700.1 locus=Glyma.15g010700 ID=Glyma.15g010700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSYCSHVFFLYSNWPTFPQVFIKGEFIGGSDIVLNMHQTGELKEKLKDIMSKQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain