SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.14g201900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.14g201900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.14g201900

Feature Type:gene_model
Chromosome:Gm14
Start:46736415
stop:46739060
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.14g201900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G32210.1AT Defender against death (DAD family) protein JGI N/AIEA
GO:0006486GO-bp protein glycosylation EnsemblGenomesN/AIEA
GO:0006487GO-bp protein N-linked glycosylation EnsemblGenomesN/AIEA
GO:0005783GO-cc endoplasmic reticulum EnsemblGenomesN/AIEA
GO:0005789GO-cc endoplasmic reticulum membrane EnsemblGenomesN/AIEA
GO:0008250GO-cc oligosaccharyltransferase complex EnsemblGenomesN/AIEA
GO:0008250GO-cc oligosaccharyltransferase complex JGI N/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane JGI N/AIEA
GO:0004576GO-mf oligosaccharyl transferase activity EnsemblGenomesN/AIEA
GO:0004579GO-mf dolichyl-diphosphooligosaccharide-protein glycotransferase activity EnsemblGenomesN/AIEA
GO:0004579GO-mf dolichyl-diphosphooligosaccharide-protein glycotransferase activity JGI N/AIEA
GO:0016740GO-mf transferase activity EnsemblGenomesN/AIEA
KOG1746 KOG Defender against cell death protein/oligosaccharyltransferase, epsilon subunit JGI N/AIEA
PTHR10705Panther DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE--PROTEIN GLYCOSYLTRANSFERASE SUBUNIT DAD1 JGI N/AIEA
PF02109PFAM DAD family JGI N/AIEA
GN7V-67353SoyCyc9-rxn Dolichyl-diphosphooligosaccharide--protein glycotransferase Plant Metabolic Network ISS

Proteins Associated with Glyma.14g201900
LocusGene SymbolProtein Name
DAD1 dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1

Expression Patterns of Glyma.14g201900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.14g201900 not represented in the dataset
Glyma.14g201900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.14g201900 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma14g38220 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.14g201900
>Glyma.14g201900.1 sequence-type=CDS polypeptide=Glyma.14g201900.1.p locus=Glyma.14g201900 ID=Glyma.14g201900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTCCTCGGTCTAGCAGCAAGGACGCCCAAGACCTTTTCCGCGCTCTTTGGTCTGCTTATGCTGCAACCCCCACTAATCTCAAGGTCCCTACATTATTCTTGTTTTTTCCACTCTTTCTCTCTTTTCCTAACCCTAATTTTACTCTTTCTTTCTTTCAGATCATTGATCTCTATGTCATCTATGCCGTATTCACCGCTTTCATCCAGGTTGTTTACATGGCTTTGGTTGGATCATTTCCATTTAACTCCTTCCTATCAGGAGTACTTTCTTGTGTAGGAACTGCTGTTCTTGCTGTTTGTCTCAGGATCCAAGTGAATAAAGAGAATAAGGAATTCAAGGATCTTGCACCTGAGCGCGCTTTTGCGGATTTTGTTCTCTGTAATTTGGTGCTTCATTTGGTGATCATGAACTTCCTTGGTTAA
Predicted protein sequences of Glyma.14g201900
>Glyma.14g201900.1.p sequence-type=predicted peptide transcript=Glyma.14g201900.1 locus=Glyma.14g201900 ID=Glyma.14g201900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAPRSSSKDAQDLFRALWSAYAATPTNLKVPTLFLFFPLFLSFPNPNFTLSFFQIIDLYVIYAVFTAFIQVVYMALVGSFPFNSFLSGVLSCVGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIMNFLG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo