SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.14g196700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.14g196700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.14g196700

Feature Type:gene_model
Chromosome:Gm14
Start:46164669
stop:46167368
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G22380.1AT Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein JGI N/AIEA
GO:0000398GO-bp mRNA splicing, via spliceosome EnsemblGenomesN/AIEA
GO:0000470GO-bp maturation of LSU-rRNA EnsemblGenomesN/AIEA
GO:0030490GO-bp maturation of SSU-rRNA EnsemblGenomesN/AIEA
GO:0042254GO-bp ribosome biogenesis EnsemblGenomesN/AIEA
GO:0005730GO-cc nucleolus EnsemblGenomesN/AIEA
GO:0031428GO-cc box C/D snoRNP complex EnsemblGenomesN/AIEA
GO:0032040GO-cc small-subunit processome EnsemblGenomesN/AIEA
GO:0046540GO-cc U4/U6 x U5 tri-snRNP complex EnsemblGenomesN/AIEA
GO:0071011GO-cc precatalytic spliceosome EnsemblGenomesN/AIEA
GO:1990904GO-cc ribonucleoprotein complex EnsemblGenomesN/AIEA
GO:0003723GO-mf RNA binding EnsemblGenomesN/AIEA
KOG3387 KOG 60S ribosomal protein 15.5kD/SNU13, NHP2/L7A family (includes ribonuclease P subunit p38), involved in splicing JGI N/AIEA
PTHR23105Panther RIBOSOMAL PROTEIN L7AE FAMILY MEMBER JGI N/AIEA
PTHR23105:SF11Panther JGI N/AIEA
PF01248PFAM Ribosomal protein L7Ae/L30e/S12e/Gadd45 family JGI N/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.14g196700 not represented in the dataset

Glyma.14g196700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.02g229800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma14g37600 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.14g196700.1 sequence-type=CDS polypeptide=Glyma.14g196700.1.p locus=Glyma.14g196700 ID=Glyma.14g196700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGACAGGAGAGACAGTGAACCCAAAAGCTTACCCTTTGGCCGATGCGCAACTCGCAATAACAATACTGGATCTTGTGCAACAAGCTGCCAACTACAAGCAACTCAAAAAGGGTGCTAATGAAGCGACCAAGACACTGAACAGAGGCATCTCTGAGTTCGTTGTGATGGCCGCGGACACTGAGCCTCTTGAGATTCTTCTCCATCTTCCTCTCCTAGCTGAGGATAAGAATGTTCCCTATGTATTCGTCCCATCAAAGCAAGCCCTTGGGCGAGCATGTGGAGTCACACGGCCAGTGATTGCATGTTCTGTAACAACTAATGAAGGAAGTCAACTGAAATCCCAAATTCAGCAACTAAAGGATGCTATTGAGAAGCTGTTAATTTGA

>Glyma.14g196700.1.p sequence-type=predicted peptide transcript=Glyma.14g196700.1 locus=Glyma.14g196700 ID=Glyma.14g196700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MTGETVNPKAYPLADAQLAITILDLVQQAANYKQLKKGANEATKTLNRGISEFVVMAADTEPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTTNEGSQLKSQIQQLKDAIEKLLI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo