Glyma.14g193000

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.14g193000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.14g193000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.14g193000

Feature Type:	gene_model
Chromosome:	Gm14
Start:	45746408
stop:	45749646
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.14g193000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G58770.1	AT	Undecaprenyl pyrophosphate synthetase family protein	JGI	N/A	IEA
GO:0016094	GO-bp	polyprenol biosynthetic process	EnsemblGenomes	N/A	IEA
GO:0005829	GO-cc	cytosol	EnsemblGenomes	N/A	IEA
GO:0002094	GO-mf	polyprenyltransferase activity	EnsemblGenomes	N/A	IEA
GO:0016740	GO-mf	transferase activity	EnsemblGenomes	N/A	IEA
GO:0016765	GO-mf	transferase activity, transferring alkyl or aryl (other than methyl) groups	EnsemblGenomes	N/A	IEA
GO:0016765	GO-mf	transferase activity, transferring alkyl or aryl (other than methyl) groups	JGI	N/A	IEA
KOG1602	KOG	Cis-prenyltransferase	JGI	N/A	IEA
PTHR10291	Panther	DEHYDRODOLICHYL DIPHOSPHATE SYNTHASE	JGI	N/A	IEA
PF01255	PFAM	Putative undecaprenyl diphosphate synthase	JGI	N/A	IEA
PWY-5807	SoyCyc9	heptaprenyl diphosphate biosynthesis	Plant Metabolic Network		ISS
GN7V-43502	SoyCyc9-rxn	heptaprenyl diphosphate synthase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.14g193000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.14g193000 not represented in the dataset	Glyma.14g193000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.14g193000

Paralog	Evidence	Comments
Glyma.02g226200	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.14g193000 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma14g37190	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.14g193000

Limit To All Plant Sequences

>Glyma.14g193000.1 sequence-type=CDS polypeptide=Glyma.14g193000.1.p locus=Glyma.14g193000 ID=Glyma.14g193000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTTCTCGTTAAGACTCCCTATTCCTCTCGTTAAAACACCACCTTCTCCCTCTTGTTATTATTCTCACTATTATCACTATCGTTATCGTTATCGTTGTTATCATCCTTTCCATCACCGTTCCCAAACACAGAGTCTTATCGTCTCGAAGCGCGGTTCCGCCATTGCGAAGTGTCACGCTGATAGCGTGACACTTCGTGATGACGGAGTCTCGCTCGCCCAAGAGTCGTTGGAGCCACTTCCGGCGGAACTCGCGGCGGAGATGATGCCGAAGCATGTGGCGGTGATAATGGACGGGAACGGGAGGTGGGCGAAGGTGAAGGGGCTGCCACCATCGGCGGGGCACCAGGCGGGGGTGCAATCGCTGAGGAAAATGGTGAGGCTGTGTTGCAGCTGGGGAATTAAGGTTCTAACGGTTTTCGCGTTCTCTACGGATAACTGGGTTCGCCCCAAGGTGGAGGTTGATTTCTTGATGAGGCTGTTTGAGAGAACAATAAACTCTGAAGTTCAAACTTTTAAGAGGGAAGGAATTAGAATATCTGTGATTGGAGATTCATCAAGGTTGCCTGAGTCTTTAAAAAGAATGATAGCTAGTGCAGAAGAGGATACAAAACAAAATTCGAGATTCCAACTTATTGTGGCAGTGGGATACAGTGGAAAATATGATGTTGTGCAAGCATGTAAAAGTGTAGCCAAGAAAGTCAAAGATGGTCACATTCACTTGGATGACATAAACGAAAACATTATTGAACAAGAATTGGAAACTAATTGTACTGAGTTTCCTTATCCTGATCTACTAATACGAACTAGTGGCGAGCTTAGAGTGAGTAACTTCTTGTTGTGGCAATTAGCCTACACAGAACTTTATTTTAATCGGGAACTCTGGCCAGATTTTGGGAAGGATGAGTTTGTAGATGCATTAAGTTCATTTCAACAAAGACAAAGACGCTATGGTGGTCGACATTCATAA

Predicted protein sequences of Glyma.14g193000

Limit To All Plant Sequences

>Glyma.14g193000.1.p sequence-type=predicted peptide transcript=Glyma.14g193000.1 locus=Glyma.14g193000 ID=Glyma.14g193000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MFSLRLPIPLVKTPPSPSCYYSHYYHYRYRYRCYHPFHHRSQTQSLIVSKRGSAIAKCHADSVTLRDDGVSLAQESLEPLPAELAAEMMPKHVAVIMDGNGRWAKVKGLPPSAGHQAGVQSLRKMVRLCCSWGIKVLTVFAFSTDNWVRPKVEVDFLMRLFERTINSEVQTFKREGIRISVIGDSSRLPESLKRMIASAEEDTKQNSRFQLIVAVGYSGKYDVVQACKSVAKKVKDGHIHLDDINENIIEQELETNCTEFPYPDLLIRTSGELRVSNFLLWQLAYTELYFNRELWPDFGKDEFVDALSSFQQRQRRYGGRHS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain