|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G35100.1 | AT | plasma membrane intrinsic protein 3 | JGI | N/A | IEA |
| GO:0006810 | GO-bp | transport | JGI | N/A | IEA |
| GO:0006833 | GO-bp | water transport | EnsemblGenomes | N/A | IEA |
| GO:0034220 | GO-bp | ion transmembrane transport | EnsemblGenomes | N/A | IEA |
| GO:0055085 | GO-bp | transmembrane transport | EnsemblGenomes | N/A | IEA |
| GO:0005887 | GO-cc | integral component of plasma membrane | EnsemblGenomes | N/A | IEA |
| GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
| GO:0016020 | GO-cc | membrane | JGI | N/A | IEA |
| GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
| GO:0005215 | GO-mf | transporter activity | JGI | N/A | IEA |
| GO:0015250 | GO-mf | water channel activity | EnsemblGenomes | N/A | IEA |
| GO:0015267 | GO-mf | channel activity | EnsemblGenomes | N/A | IEA |
| KOG0223 | KOG | Aquaporin (major intrinsic protein family) | JGI | N/A | IEA |
| PTHR19139 | Panther | AQUAPORIN TRANSPORTER | JGI | N/A | IEA |
| PTHR19139:SF50 | Panther | AQUAPORIN PIP2-7-RELATED | JGI | N/A | IEA |
| PF00230 | PFAM | Major intrinsic protein | JGI | N/A | IEA |
|
Glyma.14g153900 not represented in the dataset |
Glyma.14g153900 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma14g24424 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.14g153900.1 sequence-type=CDS polypeptide=Glyma.14g153900.1.p locus=Glyma.14g153900 ID=Glyma.14g153900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGATCTTTGTCCTCGTCTACTACACCGTCGGCATTTCTGGTGGACACATTAACACTGCCGTGACTTTTGGCCTGTTCCTGGCATGCAAGGTGTCTCTCATTCGTGCCATGTTCTACATGGTAGCACATTGTTTGGGTGCTATCTGCGGTTTTGGGTTGGTGAAGGCCTTCATGAAGCACTCCTACAACTCCCTCGGCGGTGGTGCTAACTCCGTTAGCGCTGCCTACAACAAAGGCAGTGCTCTGGGTGCGGAGATCATCGACACTTTCGTCCTTGTGTTGGCCCCATTGCCCATTGGGTTTGCTGTTTTCATGGTTCACTTGGCCACCATTCCCATCACTTGGATATTCTGGGTTGGACCATTCGTGGGAGCGTTGGTGGCGGTGGCATACCACCAGTTTATCCTAAGAGCAGTGGCTATTAAGGCCTTAGGGTCATTCAGGAACAATCCTACCAACTAG
>Glyma.14g153900.1.p sequence-type=predicted peptide transcript=Glyma.14g153900.1 locus=Glyma.14g153900 ID=Glyma.14g153900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MIFVLVYYTVGISGGHINTAVTFGLFLACKVSLIRAMFYMVAHCLGAICGFGLVKAFMKHSYNSLGGGANSVSAAYNKGSALGAEIIDTFVLVLAPLPIGFAVFMVHLATIPITWIFWVGPFVGALVAVAYHQFILRAVAIKALGSFRNNPTN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||