Glyma.14g153300

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.14g153300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.14g153300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.14g153300

Feature Type:	gene_model
Chromosome:	Gm14
Start:	33358429
stop:	33358918
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.14g153300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G47860.1	AT	chloroplastic lipocalin	JGI	N/A	IEA
GO:0036094	GO-mf	small molecule binding	EnsemblGenomes	N/A	IEA
PTHR11430	Panther	LIPOCALIN	JGI	N/A	IEA
PTHR11430:SF32	Panther	CHLOROPLASTIC LIPOCALIN	JGI	N/A	IEA
CAROTENOID-PWY	SoyCyc9	superpathway of carotenoid biosynthesis in plants	Plant Metabolic Network		ISS
PWY-5945	SoyCyc9	violaxanthin, antheraxanthin and zeaxanthin interconversion	Plant Metabolic Network		ISS
GN7V-68444	SoyCyc9-rxn	Zeaxanthin epoxidase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.14g153300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.14g153300 not represented in the dataset	Glyma.14g153300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.14g153300 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma14g24330	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.14g153300

Limit To All Plant Sequences

>Glyma.14g153300.1 sequence-type=CDS polypeptide=Glyma.14g153300.1.p locus=Glyma.14g153300 ID=Glyma.14g153300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATCAAAGAAAAATGCTATCTCCGCTTTCCTACACTGCCATTCATTCCCAAGGAACCTGATGATGTGATTGCTACAGATTATGACAATTTTTCTCTTGTTTCAGGAGCTAAGGATCAAAGTTTTATTCAGATATACTCAAGGACACCTAACCCTGGACCTGAATTGATAGAGAAGTACAATTCTTACCTTGCAAACTATGGATATGCTCCTAGCAAAACTAAAGATACGCCAGGCAATTTAATCCAACAAATCAGCAAGCATTAA

Predicted protein sequences of Glyma.14g153300

Limit To All Plant Sequences

>Glyma.14g153300.1.p sequence-type=predicted peptide transcript=Glyma.14g153300.1 locus=Glyma.14g153300 ID=Glyma.14g153300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MIKEKCYLRFPTLPFIPKEPDDVIATDYDNFSLVSGAKDQSFIQIYSRTPNPGPELIEKYNSYLANYGYAPSKTKDTPGNLIQQISKH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain