Report for Sequence Feature Glyma.14g146000
| Feature Type: | gene_model |
| Chromosome: | Gm14 |
| Start: | 26828036 |
| stop: | 26842634 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.14g146000
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT4G32910.1 | AT |
|
JGI | N/A | IEA |
Gene model name correspondences to Glyma.14g146000 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.14g146000
>Glyma.14g146000.1 sequence-type=CDS polypeptide=Glyma.14g146000.1.p locus=Glyma.14g146000 id=Glyma.14g146000.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGATGTTTGAGCTTGTAGCATATGAGTTGATGTCAGCCAATGATGCACCAGAGAGGGATCCAATGGACTGTATTTGTTTCCTTTGGGAGCAGTTGAAGCTGCTTAATTGGCAGGAATGTTCTCTTCTAAGTGTCTCTGAGACCAATCTTTTGTTGAACAAACTTCAAGAGTTGTCTCTGGCAAAGTTGCGACCCCACTACATTGAACCTTGCTTACCCCCTGATGCACTAAGCTCTATAGGTTGGCTCTAG
Predicted protein sequences of Glyma.14g146000
>Glyma.14g146000.1.p sequence-type=predicted peptide transcript=Glyma.14g146000.1 locus=Glyma.14g146000 id=Glyma.14g146000.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MMFELVAYELMSANDAPERDPMDCICFLWEQLKLLNWQECSLLSVSETNLLLNKLQELSLAKLRPHYIEPCLPPDALSSIGWL*