|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G05630.1 | AT | phospholipase D P2 | JGI | N/A | IEA |
| PTHR18896 | Panther | PHOSPHOLIPASE D | JGI | N/A | IEA |
| PTHR18896:SF2 | Panther | JGI | N/A | IEA | |
| LIPASYN-PWY | SoyCyc9 | phospholipases | Plant Metabolic Network | ISS | |
| PWY-3561 | SoyCyc9 | choline biosynthesis III | Plant Metabolic Network | ISS | |
| PWY-4762 | SoyCyc9 | superpathway of choline biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7039 | SoyCyc9 | phosphatidate metabolism, as a signaling molecule | Plant Metabolic Network | ISS | |
| GN7V-58251 | SoyCyc9-rxn | phospholipase D | Plant Metabolic Network | ISS |
|
Glyma.14g139200 not represented in the dataset |
Glyma.14g139200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma14g19881 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.14g139200.1 sequence-type=CDS polypeptide=Glyma.14g139200.1.p locus=Glyma.14g139200 ID=Glyma.14g139200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGAATGCTTTGGTTCCTTTGCTCCCATAAGAGGTTTGACTGAAGATAGGAGCCAAGCCCAATGGTTTGTAGATGGACAGGCAACATTTGAAGCAATTGCTACTTCAATTCAAGATGCAAAGTTAGAGATCTTCATTACGGGTTGGTGGTTGTGCCCAGAGCTATATCTGAGACGGCCTTTTGATAGCTTTTCTACCTCTCGGTTAGATTCATTACTAGAAGAAAAGGCTAACCAAGGGGTTCAAATCTATGTGCTTCTCTACAAGGAGGTTTCTCTAGCTTTAAAAATCAACAACTTGTACAGTATGAGAATACTGTTAAAAATTCATGAGAATGTGAGGATTTAA
>Glyma.14g139200.1.p sequence-type=predicted peptide transcript=Glyma.14g139200.1 locus=Glyma.14g139200 ID=Glyma.14g139200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MECFGSFAPIRGLTEDRSQAQWFVDGQATFEAIATSIQDAKLEIFITGWWLCPELYLRRPFDSFSTSRLDSLLEEKANQGVQIYVLLYKEVSLALKINNLYSMRILLKIHENVRI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||