SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.14g121900

Feature Type:gene_model
Chromosome:Gm14
Start:17673707
stop:17673992
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.14g121900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17790.1AT VPS35 homolog A JGI N/AIEA
GO:0006886GO-bp intracellular protein transport EnsemblGenomesN/AIEA
GO:0015031GO-bp protein transport EnsemblGenomesN/AIEA
GO:0042147GO-bp retrograde transport, endosome to Golgi EnsemblGenomesN/AIEA
GO:0005770GO-cc late endosome EnsemblGenomesN/AIEA
GO:0005829GO-cc cytosol EnsemblGenomesN/AIEA
GO:0030904GO-cc retromer complex EnsemblGenomesN/AIEA
GO:0030906GO-cc retromer, cargo-selective complex EnsemblGenomesN/AIEA
GO:0008565GO-mf protein transporter activity EnsemblGenomesN/AIEA
PTHR11099Panther VACUOLAR SORTING PROTEIN 35 JGI N/AIEA
PF03635PFAM Vacuolar protein sorting-associated protein 35 JGI N/AIEA

Expression Patterns of Glyma.14g121900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.14g121900 not represented in the dataset
Glyma.14g121900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.14g121900 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma14g28071 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.14g121900
>Glyma.14g121900.1 sequence-type=CDS polypeptide=Glyma.14g121900.1.p locus=Glyma.14g121900 ID=Glyma.14g121900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATTGCGTTGAAGCTTTCAAATTATCCTCGCGTAATAGAATACCTTCATATTCCGACTACGAAGGTCATGGCAACTGTTATTATTCAAAGCATTATGAAAAACGGAAAATGCATTTCTACTTCAGAAAAGGTTGAAGCATTGTTTGAACTGATAAAGGGGCTTATCAAGGATTCTGATGGGATCCCTAATGATGAGGTCATTTTAGTACCATGA
Predicted protein sequences of Glyma.14g121900
>Glyma.14g121900.1.p sequence-type=predicted peptide transcript=Glyma.14g121900.1 locus=Glyma.14g121900 ID=Glyma.14g121900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MIALKLSNYPRVIEYLHIPTTKVMATVIIQSIMKNGKCISTSEKVEALFELIKGLIKDSDGIPNDEVILVP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo