SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.14g120400

Feature Type:gene_model
Chromosome:Gm14
Start:17050528
stop:17052976
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.14g120400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G43600.1AT ureidoglycolate amidohydrolase JGI N/AIEA
GO:0008152GO-bp metabolic process EnsemblGenomesN/AIEA
GO:0008152GO-bp metabolic process JGI N/AIEA
GO:0016787GO-mf hydrolase activity EnsemblGenomesN/AIEA
GO:0016787GO-mf hydrolase activity JGI N/AIEA
GO:0016813GO-mf hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines EnsemblGenomesN/AIEA
PTHR11014Panther PEPTIDASE M20 FAMILY MEMBER JGI N/AIEA
PTHR11014:SF27Panther PROTEIN C44E12.1 JGI N/AIEA
PF01546PFAM Peptidase family M20/M25/M40 JGI N/AIEA
PWY-5692SoyCyc9 allantoin degradation to glyoxylate II Plant Metabolic Network ISS
URDEGR-PWYSoyCyc9 superpathway of allantoin degradation in plants Plant Metabolic Network ISS
GN7V-47325SoyCyc9-rxn ureidoglycolate hydrolase Plant Metabolic Network ISS

Expression Patterns of Glyma.14g120400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.14g120400 not represented in the dataset
Glyma.14g120400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.14g120400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma14g27625 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.14g120400
>Glyma.14g120400.1 sequence-type=CDS polypeptide=Glyma.14g120400.1.p locus=Glyma.14g120400 ID=Glyma.14g120400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATTAAGTTTACTTTAGATATCATTTGGAGTAGAAATCATGTTGGTTTGGCTCCTTCTGAATTAGCCCTGGCTATAGAGAGGCATGTGTTGGATTGTGGTTCAATTGATAATGTTGGCACTGCCGGTATCTTGGAACTGCATCTTGGAGCAATCAACAACATCCCCAACAAATGTCACCTAGAAATTGACACAAGAGACATTGATGAGGAAAGAAGAAATAAAGTGGTTGACAAAATTCATCAATCAGCAATTAAAATAACCAAAACACGAGGTGTCAAGTTCTCTCATTTCCGTGTCATCAATCAGGATCCACTATCCCTTTCTAATGAAGCAGTCATGAAGGCAGTAGAGACTGCAACAAAAGAACTAAACTTGACAAGCAAGTTGATGATTAGTAGAGCCTATCATGATTCATTGCTTATGGCCAGGTTGTCTCCAATGGGCATGATTTTCATTCCATGGTACAAAGGGTACAACCATAAGCCTAAAGAGTTTGCCACCATTGAAGATATGTCAAATGGTGTAAACGTATCGGCGCTCACCCTAGCCAAATTGTCCAGTCAATAA
Predicted protein sequences of Glyma.14g120400
>Glyma.14g120400.1.p sequence-type=predicted peptide transcript=Glyma.14g120400.1 locus=Glyma.14g120400 ID=Glyma.14g120400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MIKFTLDIIWSRNHVGLAPSELALAIERHVLDCGSIDNVGTAGILELHLGAINNIPNKCHLEIDTRDIDEERRNKVVDKIHQSAIKITKTRGVKFSHFRVINQDPLSLSNEAVMKAVETATKELNLTSKLMISRAYHDSLLMARLSPMGMIFIPWYKGYNHKPKEFATIEDMSNGVNVSALTLAKLSSQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo