SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.14g117000

Feature Type:gene_model
Chromosome:Gm14
Start:14412965
stop:14414611
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G60890.1AT Phosphatidylinositol-4-phosphate 5-kinase family protein JGI N/AIEA
GO:0016310GO-bp phosphorylation EnsemblGenomesN/AIEA
GO:0046488GO-bp phosphatidylinositol metabolic process EnsemblGenomesN/AIEA
GO:0046488GO-bp phosphatidylinositol metabolic process JGI N/AIEA
GO:0046854GO-bp phosphatidylinositol phosphorylation EnsemblGenomesN/AIEA
GO:0000166GO-mf nucleotide binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0016301GO-mf kinase activity EnsemblGenomesN/AIEA
GO:0016307GO-mf phosphatidylinositol phosphate kinase activity EnsemblGenomesN/AIEA
GO:0016307GO-mf phosphatidylinositol phosphate kinase activity JGI N/AIEA
GO:0016740GO-mf transferase activity EnsemblGenomesN/AIEA
PTHR23086Panther PHOSPHATIDYLINOSITOL-4-PHOSPHATE 5-KINASE JGI N/AIEA
PTHR23086:SF6Panther JGI N/AIEA
PF01504PFAM Phosphatidylinositol-4-phosphate 5-Kinase JGI N/AIEA
PWY-6351SoyCyc9 D-myo-inositol (1,4,5)-trisphosphate biosynthesis Plant Metabolic Network ISS
PWY-6352SoyCyc9 3-phosphoinositide biosynthesis Plant Metabolic Network ISS
GN7V-41091SoyCyc9-rxn 1-phosphatidylinositol-4-phosphate 5-kinase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.14g117000 not represented in the dataset

Glyma.14g117000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma14g14471 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.14g117000.1 sequence-type=CDS polypeptide=Glyma.14g117000.1.p locus=Glyma.14g117000 ID=Glyma.14g117000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTTTAGTAATATTTATTGGAACGCTTTCCATCTGGCTACAGTAGGATCAACTTATTTCAAAGTTGTAAGGAATTTGAGAGAGATGTTAAAATTAGATGTTGCAGAGTACATGATGTCCATTTGTGGTGATTCTGGTCTAAGGGACATATCTTCACCTGGAAAAAGTGGTAACATCTTCTTTCTTTCTCAAGATGATAGATTCATGATAAAGACACTGAAAAAATATGAACTAAAGGTAATGCTCAATATGCTTCCTAAATACTATTATCATGTAGGAAGTTATGAGAATACTCTTATTACAAAATTCTTTGGTCTTCATTGA

>Glyma.14g117000.1.p sequence-type=predicted peptide transcript=Glyma.14g117000.1 locus=Glyma.14g117000 ID=Glyma.14g117000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MFSNIYWNAFHLATVGSTYFKVVRNLREMLKLDVAEYMMSICGDSGLRDISSPGKSGNIFFLSQDDRFMIKTLKKYELKVMLNMLPKYYYHVGSYENTLITKFFGLH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo