SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.14g105300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.14g105300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.14g105300

Feature Type:gene_model
Chromosome:Gm14
Start:10834496
stop:10835539
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.14g105300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G05710.1AT aconitase 3 JGI N/AIEA
GO:0008152GO-bp metabolic process EnsemblGenomesN/AIEA
GO:0008152GO-bp metabolic process JGI N/AIEA
PTHR11670Panther ACONITASE JGI N/AIEA
PTHR11670:SF1Panther IRON REGULATORY PROTEIN 1A-RELATED JGI N/AIEA
PF00330PFAM Aconitase family (aconitate hydratase) JGI N/AIEA
GLYOXYLATE-BYPASSSoyCyc9 glyoxylate cycle Plant Metabolic Network ISS
PWY-5464SoyCyc9 superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle Plant Metabolic Network ISS
PWY-561SoyCyc9 superpathway of glyoxylate cycle and fatty acid degradation Plant Metabolic Network ISS
PWY-5690SoyCyc9 TCA cycle II (plants and fungi) Plant Metabolic Network ISS
PWY-6549SoyCyc9 L-glutamine biosynthesis III Plant Metabolic Network ISS
GN7V-46281SoyCyc9-rxn Enzyme name not determined Plant Metabolic Network ISS

Expression Patterns of Glyma.14g105300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.14g105300 not represented in the dataset
Glyma.14g105300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.14g105300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma14g12315 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.14g105300
>Glyma.14g105300.1 sequence-type=CDS polypeptide=Glyma.14g105300.1.p locus=Glyma.14g105300 ID=Glyma.14g105300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCGTGTTTTATCTTTAACCCGTTTTTTCTCCTCTCCTCTGGATTTTACTGGAATCCCTGCTGTTGTTGACCTGGCTTGCGTGCGTGATGCTAGGAATAAGCTTGGCAGTGATTCTAATAAGATTAATCCTCTGGTTCCTGTTGATCTTGTCATTAATCATTCAGTTCAAGTTGATGTAGCAAGGTCAGAGAATGTAAGAAACAATGAGAGATTTGCTTTTCTTAAATGGGGATCAAATGCTTTCCGTAATATGCTTGTTGTCCCTCCTGGATCTGGTATAGTACATCAGGTCAATCTTGAATATCTTGGACGCATTGTTTTCAATACTGAGGGCTTGTTGTATCCTGACAGTGTAGTTGGAACTGCTTCACATACAACAATGATAGATAGGCTTGGAGTTGCTGGATGGGGCTTTGGTGGTATTGAAGCAGAGGCAACAGTGCTTGGCAAGCCTATGAGCATGGTGTTATGTGTTGTTGGGTTCAAGTTATCTGGAAAACTGTGTAATGGTGTTACAACAACTGACTTGGTTCTAACTGTGACACAAATTCTTAGGAAACATGGTGTTGTAGGGAAATTTGTTGAATTTTATGGTAATTAA
Predicted protein sequences of Glyma.14g105300
>Glyma.14g105300.1.p sequence-type=predicted peptide transcript=Glyma.14g105300.1 locus=Glyma.14g105300 ID=Glyma.14g105300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MRVLSLTRFFSSPLDFTGIPAVVDLACVRDARNKLGSDSNKINPLVPVDLVINHSVQVDVARSENVRNNERFAFLKWGSNAFRNMLVVPPGSGIVHQVNLEYLGRIVFNTEGLLYPDSVVGTASHTTMIDRLGVAGWGFGGIEAEATVLGKPMSMVLCVVGFKLSGKLCNGVTTTDLVLTVTQILRKHGVVGKFVEFYGN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo