Report for Sequence Feature Glyma.14g100100
Feature Type: | gene_model |
Chromosome: | Gm14 |
Start: | 10019744 |
stop: | 10021379 |
Source: | JGI |
Version: | Wm82.a4.v1 |
High confidence: | yes |
| 
|
Annotations for Glyma.14g100100
Proteins Associated with Glyma.14g100100
Locus | Gene Symbol | Protein Name |
| WRKY131 | WRKY Transcripiton Factor |
Gene model name correspondences to Glyma.14g100100 Gene Call Version Wm82.a4.v1
Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.14g100100
>Glyma.14g100100.1 sequence-type=CDS polypeptide=Glyma.14g100100.1.p locus=Glyma.14g100100 id=Glyma.14g100100.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGTCAGAGATTGAAGTACTTGACGATGGCTACAGATGGAGGAAGTACGGAAAGAAAATGGTGAAAAAATGCCCAAATCCAAGGAATAACTACAGGTGTTCAGTGGATGGATGCACTGTGAAAAAGAGAGTGGAGAGAGACAAGGATGACCCAAGGTATGTAATAACAACCTACGAAGGCAACCACACTCATCCAACTTCTTCCTAG
Predicted protein sequences of Glyma.14g100100
>Glyma.14g100100.1.p sequence-type=predicted peptide transcript=Glyma.14g100100.1 locus=Glyma.14g100100 id=Glyma.14g100100.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MSEIEVLDDGYRWRKYGKKMVKKCPNPRNNYRCSVDGCTVKKRVERDKDDPRYVITTYEGNHTHPTSS*