SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.13g253800

Feature Type:gene_model
Chromosome:Gm13
Start:35984370
stop:35987199
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G21860.1AT methionine sulfoxide reductase B 2 JGI N/AIEA
GO:0006979GO-bp response to oxidative stress EnsemblGenomesN/AIEA
GO:0030091GO-bp protein repair EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0016671GO-mf oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor EnsemblGenomesN/AIEA
GO:0033743GO-mf peptide-methionine (R)-S-oxide reductase activity EnsemblGenomesN/AIEA
GO:0033743GO-mf peptide-methionine (R)-S-oxide reductase activity JGI N/AIEA
KOG0856 KOG Predicted pilin-like transcription factor JGI N/AIEA
PTHR10173Panther METHIONINE SULFOXIDE REDUCTASE JGI N/AIEA
PTHR10173:SF0Panther JGI N/AIEA
PF01641PFAM SelR domain JGI N/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.15g061100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma13g32680 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.13g253800.1 sequence-type=CDS polypeptide=Glyma.13g253800.1.p locus=Glyma.13g253800 ID=Glyma.13g253800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGATTGAGTATTCTGAGAAGCACTTCCATTTCCACTCCTATCTCTTCCTCCAAATCCAAACCCATTTTCTCAACTCTTGTTCGTTCATCTTTCGCCTCCATTTCCCCCACAAAGTGTGTTACTCCCACCACTCTTTTCGTTTCTGCCACCCCCTTCTTCACCGCCTCACCCAAGCGCGGCTTTCGTGGTGGGATTGTGGCCATGGCCGCCGCTGGCTCGCTCCGCAAATCAGAGGAAGAGTGGCGCGCAGTTCTCTCCCCTGAACAGTTTCGTATTCTCAGGCAAAAGGGCACCGAGTTCCCTGGAACAGGAGAGTATGACAAGTTCTTTGATGAGGGAGTTTACAACTGTGCTGGTTGTGGGACACCTCTCTACAGGTCCTTAACAAAATTCAATTCTGGTTGTGGCTGGCCAGCCTTCTATGAGGGGATTCCTGGAGCCATAAATCGCAATCCGGACCCTGATGGGATGAGGACAGAAATAACGTGTGCTGCTTGTGGGGGACATCTAGGTCACGTCTTTAAAGGAGAAGGATTTCCAACGCCCACTAACGAACGCCATTGTGTCAATAGCATTTCACTGAAATTTGCGCCAGCCAATTCTTAA

>Glyma.13g253800.1.p sequence-type=predicted peptide transcript=Glyma.13g253800.1 locus=Glyma.13g253800 ID=Glyma.13g253800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGLSILRSTSISTPISSSKSKPIFSTLVRSSFASISPTKCVTPTTLFVSATPFFTASPKRGFRGGIVAMAAAGSLRKSEEEWRAVLSPEQFRILRQKGTEFPGTGEYDKFFDEGVYNCAGCGTPLYRSLTKFNSGCGWPAFYEGIPGAINRNPDPDGMRTEITCAACGGHLGHVFKGEGFPTPTNERHCVNSISLKFAPANS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo