|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G29810.1 | AT | Transcriptional coactivator/pterin dehydratase | JGI | N/A | IEA |
GO:0006729 | GO-bp | tetrahydrobiopterin biosynthetic process | EnsemblGenomes | N/A | IEA |
GO:0006729 | GO-bp | tetrahydrobiopterin biosynthetic process | JGI | N/A | IEA |
GO:0008124 | GO-mf | 4-alpha-hydroxytetrahydrobiopterin dehydratase activity | EnsemblGenomes | N/A | IEA |
GO:0008124 | GO-mf | 4-alpha-hydroxytetrahydrobiopterin dehydratase activity | JGI | N/A | IEA |
KOG4073 | KOG | Pterin carbinolamine dehydratase PCBD/dimerization cofactor of HNF1 | JGI | N/A | IEA |
PTHR12599 | Panther | PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASE | JGI | N/A | IEA |
PF01329 | PFAM | Pterin 4 alpha carbinolamine dehydratase | JGI | N/A | IEA |
PWY-7158 | SoyCyc9 | L-phenylalanine degradation V | Plant Metabolic Network | ISS | |
GN7V-66951 | SoyCyc9-rxn | 4a-hydroxytetrahydrobiopterin dehydratase | Plant Metabolic Network | ISS |
Glyma.13g234000 not represented in the dataset |
Glyma.13g234000 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.15g079000 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
>Glyma.13g234000.1 sequence-type=CDS polypeptide=Glyma.13g234000.1.p locus=Glyma.13g234000 ID=Glyma.13g234000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGACTCGTCAACGAACTTATCAACTGAGAACTGTGTACCGTGCAATACAAAGGACTTGCAGCCCATGACCGAGGATGCAGCACGCACAATGCTTCAACAGATTGCCCAGTGGAATTTGGTTAATGAGGATGGTGTGTTGAAATTGAGGAGATCATGGAAAGTAAAGACTTTTACCAAAGGATTGGAATTTTTCAGGATAATAGCTGGTCTTGCTGAAGCTGAAGGTCATCATCCTGATCTTCACCTTGTTGGCTGGAATAATGTTACTATAGAGATTTGGACGCATTCTGTGGTAATCCATGTTTATGTAGGTGGGCTGACACAGAATGACTTCATTCTAGCTGCTAAGATCAATGAGCTTAATTTGCATGACTTGCTAAGACGGAAGACTTCTAACTGA
>Glyma.13g234000.1.p sequence-type=predicted peptide transcript=Glyma.13g234000.1 locus=Glyma.13g234000 ID=Glyma.13g234000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MDSSTNLSTENCVPCNTKDLQPMTEDAARTMLQQIAQWNLVNEDGVLKLRRSWKVKTFTKGLEFFRIIAGLAEAEGHHPDLHLVGWNNVTIEIWTHSVVIHVYVGGLTQNDFILAAKINELNLHDLLRRKTSN*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||