Glyma.13g193500

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.13g193500

Feature Type:	gene_model
Chromosome:	Gm13
Start:	30669375
stop:	30676126
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.13g193500

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G38730.1	AT	Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein	JGI	N/A	IEA
GO:0000413	GO-bp	protein peptidyl-prolyl isomerization	EnsemblGenomes	N/A	IEA
GO:0006457	GO-bp	protein folding	EnsemblGenomes	N/A	IEA
GO:0006457	GO-bp	protein folding	JGI	N/A	IEA
GO:0003755	GO-mf	peptidyl-prolyl cis-trans isomerase activity	EnsemblGenomes	N/A	IEA
GO:0003755	GO-mf	peptidyl-prolyl cis-trans isomerase activity	JGI	N/A	IEA
GO:0016853	GO-mf	isomerase activity	EnsemblGenomes	N/A	IEA
KOG0879	KOG	U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase	JGI	N/A	IEA
PTHR11071	Panther	PEPTIDYL-PROLYL CIS-TRANS ISOMERASE	JGI	N/A	IEA
PTHR11071:SF58	Panther	PEPTIDYL-PROLYL CIS-TRANS ISOMERASE H	JGI	N/A	IEA
PF00160	PFAM	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD	JGI	N/A	IEA

Expression Patterns of Glyma.13g193500

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.13g193500

Paralog	Evidence	Comments
Glyma.09g090900	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Glyma.15g231800	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.13g193500 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma13g26260	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.13g193500

Limit To All Plant Sequences

>Glyma.13g193500.1 sequence-type=CDS polypeptide=Glyma.13g193500.1.p locus=Glyma.13g193500 ID=Glyma.13g193500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTGGTTCAATTGGAAGCGGAGGGAACACAAGCACGGGTGTGGAGTGGCACGTGCGACCTCCAAACCCTAAGAATCCCATCGTCTTCTTCGATGTCACCATCGGTAACATTCCCGCCGGTCGAATCAAGATGGAACTCTTCGCCGATATTGCCCCCAAAACTGCCGAGAATTTCAGGCAGTTCTGCACTGGGGAATACAGGAAAGCAGGACTGCCTGTTGGTTACAAGGGTTGTCAATTTCATAGAGTTATTAAGGATTTTATGATTCAGGCTGGTGATTTTGTAAAGGGAGATGGTAGTGGATGTGTTTCCATCTATGGACTCAAGTTTGATGATGAAAACTTTACGGCCAAACACACTGGTCCTGGCCTTCTGTCGATGGCAAATAGCGGACAAAATACCAATGGCTGTCAGTTCTTTATAACATGTGCAAAATGTGACTGGCTTGACAACAAGCATGTTGTCTTTGGGAGAGTGCTGGGAGATGGTCTTTTGGTTGTCAGGAAGATTGAGAACGTGGCAACCGGACCAATAACCGGCCAAAATTAG

Predicted protein sequences of Glyma.13g193500

Limit To All Plant Sequences

>Glyma.13g193500.1.p sequence-type=predicted peptide transcript=Glyma.13g193500.1 locus=Glyma.13g193500 ID=Glyma.13g193500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAGSIGSGGNTSTGVEWHVRPPNPKNPIVFFDVTIGNIPAGRIKMELFADIAPKTAENFRQFCTGEYRKAGLPVGYKGCQFHRVIKDFMIQAGDFVKGDGSGCVSIYGLKFDDENFTAKHTGPGLLSMANSGQNTNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVVRKIENVATGPITGQN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain