SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.13g173800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.13g173800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.13g173800

Feature Type:gene_model
Chromosome:Gm13
Start:28778148
stop:28780026
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.13g173800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G76790.1AT O-methyltransferase family protein JGI N/AIEA
GO:0019438GO-bp aromatic compound biosynthetic process EnsemblGenomesN/AIEA
GO:0032259GO-bp methylation EnsemblGenomesN/AIEA
GO:0008168GO-mf methyltransferase activity EnsemblGenomesN/AIEA
GO:0008171GO-mf O-methyltransferase activity EnsemblGenomesN/AIEA
GO:0008171GO-mf O-methyltransferase activity JGI N/AIEA
GO:0008757GO-mf S-adenosylmethionine-dependent methyltransferase activity EnsemblGenomesN/AIEA
PTHR11746Panther O-METHYLTRANSFERASE JGI N/AIEA
PF00891PFAM O-methyltransferase JGI N/AIEA
PWY-2229SoyCyc9 superpathway of pterocarpan biosynthesis (via formononetin) Plant Metabolic Network ISS
PWY-2321SoyCyc9 formononetin biosynthesis Plant Metabolic Network ISS
PWY-2467SoyCyc9 (+)-pisatin biosynthesis Plant Metabolic Network ISS
GN7V-47497SoyCyc9-rxn (+)-6a-hydroxymaackiain 3-O-methyltransferase Plant Metabolic Network ISS

Expression Patterns of Glyma.13g173800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.13g173800 not represented in the dataset
Glyma.13g173800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.13g173800 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma13g24225 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.13g173800
>Glyma.13g173800.1 sequence-type=CDS polypeptide=Glyma.13g173800.1.p locus=Glyma.13g173800 ID=Glyma.13g173800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAAGGAACCCCAAATTTGAACTTTGTTGGTGGTGATAGGTTCAACTCCATCTCTTCTGCTGATGCAGTTTTACTCAAGTGGATTTTGCATGATTGGAATGAGGAACTCTCCCTGAAGATATTGAATAACTACAAAGAAGCCATTTCTAGCAAAGGGAAAAGAGGAAAGGTGATAATCATAGACATAGCAATTGATGAAGCAGGTGATGGTCGCAAAATAACCGAGTTGAAGTTGGACTTTGAGTTGGTGATGCTTACTATGTTCAATGGAAAAGAGAGAGAAAAGGAAAGAATGAGAGAATATTATATACGACGGTGGCTTCAGTATCTACAAGATTACGCCTGTGTTTGA
Predicted protein sequences of Glyma.13g173800
>Glyma.13g173800.1.p sequence-type=predicted peptide transcript=Glyma.13g173800.1 locus=Glyma.13g173800 ID=Glyma.13g173800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKGTPNLNFVGGDRFNSISSADAVLLKWILHDWNEELSLKILNNYKEAISSKGKRGKVIIIDIAIDEAGDGRKITELKLDFELVMLTMFNGKEREKERMREYYIRRWLQYLQDYACV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo