|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G65360.1 | AT | Histone superfamily protein | JGI | N/A | IEA |
GO:0006334 | GO-bp | nucleosome assembly | EnsemblGenomes | N/A | IEA |
GO:0000786 | GO-cc | nucleosome | EnsemblGenomes | N/A | IEA |
GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
GO:0005694 | GO-cc | chromosome | EnsemblGenomes | N/A | IEA |
GO:0003677 | GO-mf | DNA binding | EnsemblGenomes | N/A | IEA |
GO:0003677 | GO-mf | DNA binding | JGI | N/A | IEA |
GO:0031492 | GO-mf | nucleosomal DNA binding | EnsemblGenomes | N/A | IEA |
GO:0046982 | GO-mf | protein heterodimerization activity | EnsemblGenomes | N/A | IEA |
KOG1745 | KOG | Histones H3 and H4 | JGI | N/A | IEA |
PTHR11426 | Panther | HISTONE H3 | JGI | N/A | IEA |
PF00125 | PFAM | Core histone H2A/H2B/H3/H4 | JGI | N/A | IEA |
Glyma.13g173100 not represented in the dataset |
Glyma.13g173100 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.07g202500 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma13g24180 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.13g173100.1 sequence-type=CDS polypeptide=Glyma.13g173100.1.p locus=Glyma.13g173100 ID=Glyma.13g173100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTCGTACGAAGCAAACGGCTCGCAAGTCCACCGGCGGCAAGGCGCCACGTAAGCAGCTGGCCACCAAGGCGGCTCGTAAGTCTGCTCCGGCTACCGGCGGCGTGAAGAAGCCGCACAGATTCCGTCCGGGAACCGTAGCGCTCCGCGAGATCCGGAAGTACCAGAAGAGCACGGAACTTCTGATCCGGAAGCTCCCGTTCCAGCGATTGGTCCGTGAGATCGCGCAGGACTTCAAGACCGACCTTCGATTTCAGAGCTCCGCCGTCTCCGCCCTCCAGGAAGCCGCCGAGGCCTACTTGGTTGGTCTCTTCGAAGACACCAATCTCTGCGCTATTCACGCCAAGCGTGTCACTATCATGCCCAAGGATATTCAACTCGCTAGGCGTATTAGGGGCGAGCGCGCTTAA
>Glyma.13g173100.1.p sequence-type=predicted peptide transcript=Glyma.13g173100.1 locus=Glyma.13g173100 ID=Glyma.13g173100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||