SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.13g170400

Feature Type:gene_model
Chromosome:Gm13
Start:28430411
stop:28433805
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.13g170400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G05780.1AT Vacuolar ATPase assembly integral membrane protein VMA21-like domain JGI N/AIEA
GO:0070072GO-bp vacuolar proton-transporting V-type ATPase complex assembly EnsemblGenomesN/AIEA
GO:0005783GO-cc endoplasmic reticulum EnsemblGenomesN/AIEA
GO:0005789GO-cc endoplasmic reticulum membrane EnsemblGenomesN/AIEA
GO:0012507GO-cc ER to Golgi transport vesicle membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0031410GO-cc cytoplasmic vesicle EnsemblGenomesN/AIEA
GO:0033116GO-cc endoplasmic reticulum-Golgi intermediate compartment membrane EnsemblGenomesN/AIEA
PF09446PFAM VMA21-like domain JGI N/AIEA

Expression Patterns of Glyma.13g170400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.13g170400
ParalogEvidenceComments
Glyma.19g010500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.13g170400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma13g23940 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.13g170400
>Glyma.13g170400.1 sequence-type=CDS polypeptide=Glyma.13g170400.1.p locus=Glyma.13g170400 ID=Glyma.13g170400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGAGTTATTCAGAAGTTTTTCGTTGCATCACTGTTCATGTGGGCAATTCCTATTGCAATATTATATGCTTTTAACCATAATATACTTCCTGGAGCATCCAATTTGTCCCCTTACTCTATGACACTAGTGAGTGGATTTCTTGCTGTCATATCTGTCAATGTGGTGATAGCATTTTACATATATTTGGCATTGAGAGAACCTACGGCGGATAAACCCGAGCCTGATCCTAAATTTCTTGCTGAGGCCAAAGCTAGCATCAATCAGTCTACAGGGGATGCTCAACAACCTTCCCAGGCTCTCAAGAAAGAACAGTAG
Predicted protein sequences of Glyma.13g170400
>Glyma.13g170400.1.p sequence-type=predicted peptide transcript=Glyma.13g170400.1 locus=Glyma.13g170400 ID=Glyma.13g170400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGVIQKFFVASLFMWAIPIAILYAFNHNILPGASNLSPYSMTLVSGFLAVISVNVVIAFYIYLALREPTADKPEPDPKFLAEAKASINQSTGDAQQPSQALKKEQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo