| 
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT3G51370.1 | AT | Protein phosphatase 2C family protein | JGI | N/A | IEA | 
| GO:0006470 | GO-bp | protein dephosphorylation | EnsemblGenomes | N/A | IEA | 
| GO:0004722 | GO-mf | protein serine/threonine phosphatase activity | EnsemblGenomes | N/A | IEA | 
| PTHR13832 | Panther | PROTEIN PHOSPHATASE 2C | JGI | N/A | IEA | 
| PTHR13832:SF97 | Panther | JGI | N/A | IEA | 
| 
			 Glyma.13g148800 not represented in the dataset  | 
			 Glyma.13g148800 not represented in the dataset  | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection  | 
			Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome  | 
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|---|---|---|
| Glyma13g21260 | Wm82.a1.v1.1 | IGC | As supplied by JGI | 
>Glyma.13g148800.1 sequence-type=CDS polypeptide=Glyma.13g148800.1.p locus=Glyma.13g148800 ID=Glyma.13g148800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGTTATGTCGTGTTGGAAGCAAATTGTTGATGGTGATGAAGGAGATGAGAGTGGGAGAGTTGATGGTCTTTTACGGTACAAGGATTTGGGGAACCACCTTTATGGGGAATTCTCAATGGTTGTGGTTCAGGACAATAGTTCATTAGAGGACCGAGGTGAACTTGAGTCTAGACCCTTGAGTTCTAATCACTTGGGTCCTCAAGGGACTTTTATAGGTGTTTATGATGGCCATGATGGAAGTGAGGCTTCATAG
>Glyma.13g148800.1.p sequence-type=predicted peptide transcript=Glyma.13g148800.1 locus=Glyma.13g148800 ID=Glyma.13g148800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MVMSCWKQIVDGDEGDESGRVDGLLRYKDLGNHLYGEFSMVVVQDNSSLEDRGELESRPLSSNHLGPQGTFIGVYDGHDGSEAS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||