Report for Sequence Feature Glyma.13g140500
| Feature Type: | gene_model |
| Chromosome: | Gm13 |
| Start: | 24395571 |
| stop: | 24396765 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.13g140500
Proteins Associated with Glyma.13g140500
| Locus | Gene Symbol | Protein Name |
| | IAA42 | Indole-3-Acetic Acid Responsive Gene 42 |
Gene model name correspondences to Glyma.13g140500 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma13g20374 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.13g140500
>Glyma.13g140500.1 sequence-type=CDS polypeptide=Glyma.13g140500.1.p locus=Glyma.13g140500 id=Glyma.13g140500.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGAGACTGGCCATTGTAAAGTTTTTATGGAGTCCGAAGATGTAGGCCGAACTATGGACCTATCGTTGCTTCGATCTTACGATGAATTACATAGAAAGTTGGCAGACATGTTTGGCATAGAAAAATCTGAAATGTTAAGTAGGGTGCTTTACTGCGATTCAGTTGGGGCTATCAAACACATTGGTGATGAGCCATTCAGTGACTTCACAAGAACAGCCAAAAGGTTGACTATTCTAATGGATTCTGGCAGCAACAATGTAGGAGTGTAG
Predicted protein sequences of Glyma.13g140500
>Glyma.13g140500.1.p sequence-type=predicted peptide transcript=Glyma.13g140500.1 locus=Glyma.13g140500 id=Glyma.13g140500.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
METGHCKVFMESEDVGRTMDLSLLRSYDELHRKLADMFGIEKSEMLSRVLYCDSVGAIKHIGDEPFSDFTRTAKRLTILMDSGSNNVGV*