|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G04620.2 | AT | biotin F | JGI | N/A | IEA |
| GN7V-65095 | SoyCyc9-rxn | 8-amino-7-oxononanoate synthase | Plant Metabolic Network | ISS |
|
Glyma.13g111300 not represented in the dataset |
Glyma.13g111300 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma13g17111 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.13g111300.1 sequence-type=CDS polypeptide=Glyma.13g111300.1.p locus=Glyma.13g111300 ID=Glyma.13g111300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCAGACGCCAATTGCATGCTGGGACAACTGGGTCGGAGAGGCGCTCGAGACCCTTTACTCTCTCAGACCCATTTGCCTCCGCAATAGCCAGCCTCGAGAATTCGGGGCGGACGATGGTGCGTTCCAAGTGTTCGACGAAATGCAGCAGCGGGACCGATCTTCTGTCGAAGTGGAAATTGCTGAAACCACGTTTAGTAGATGGATGCATGACACCCCAGTTCTGGAGATTGGCATCCTCGATAGTCTCCGAAGTTGA
>Glyma.13g111300.1.p sequence-type=predicted peptide transcript=Glyma.13g111300.1 locus=Glyma.13g111300 ID=Glyma.13g111300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MQTPIACWDNWVGEALETLYSLRPICLRNSQPREFGADDGAFQVFDEMQQRDRSSVEVEIAETTFSRWMHDTPVLEIGILDSLRS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||