Glyma.13g090900

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.13g090900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.13g090900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.13g090900

Feature Type:	gene_model
Chromosome:	Gm13
Start:	20569584
stop:	20573299
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.13g090900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G22450.1	AT	cytochrome C oxidase 6B	JGI	N/A	IEA
GO:0005739	GO-cc	mitochondrion	EnsemblGenomes	N/A	IEA
GO:0005739	GO-cc	mitochondrion	JGI	N/A	IEA
GO:0004129	GO-mf	cytochrome-c oxidase activity	JGI	N/A	IEA
PTHR11387	Panther	CYTOCHROME C OXIDASE POLYPEPTIDE VIB	JGI	N/A	IEA
PTHR11387:SF2	Panther	PROTEIN Y71H2AM.5	JGI	N/A	IEA
PF02297	PFAM	Cytochrome oxidase c subunit VIb	JGI	N/A	IEA
PWY-3781	SoyCyc9	aerobic respiration I (cytochrome c)	Plant Metabolic Network		ISS
GN7V-66112	SoyCyc9-rxn	cytochrome-c oxidase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.13g090900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.13g090900 not represented in the dataset	Glyma.13g090900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.13g090900

Paralog	Evidence	Comments
Glyma.17g069400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.13g090900 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma13g01590	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.13g090900

Limit To All Plant Sequences

>Glyma.13g090900.1 sequence-type=CDS polypeptide=Glyma.13g090900.1.p locus=Glyma.13g090900 ID=Glyma.13g090900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGGAGATTGAACTGAAAACTGCACCTGCTGATTTTCGTTTTCCTACAACAAATCAAACCAGACATTGTTTCACTCGCTACATAGAGTTTCACAGATGCTTGGCAGCAAAGGGTGAAAACTCTGGTGAATGTGAGAGATTTGCTAAATATTACCGCTCCCTTTGCCCGGGTGAATGGGTTGAAAGGTGGAATGAACAGAGGGAGAGTGGGACTTTTCCAGGACCTCTTTGA

Predicted protein sequences of Glyma.13g090900

Limit To All Plant Sequences

>Glyma.13g090900.1.p sequence-type=predicted peptide transcript=Glyma.13g090900.1 locus=Glyma.13g090900 ID=Glyma.13g090900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAEIELKTAPADFRFPTTNQTRHCFTRYIEFHRCLAAKGENSGECERFAKYYRSLCPGEWVERWNEQRESGTFPGPL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain