SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.13g069100

Feature Type:gene_model
Chromosome:Gm13
Start:16887570
stop:16893225
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.13g069100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G04700.1AT ferredoxin thioredoxin reductase catalytic beta chain family protein JGI N/AIEA
GO:0022900GO-bp electron transport chain EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0009507GO-cc chloroplast EnsemblGenomesN/AIEA
GO:0009536GO-cc plastid EnsemblGenomesN/AIEA
GO:0008937GO-mf ferredoxin-NAD(P) reductase activity JGI N/AIEA
GO:0009055GO-mf electron transfer activity EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
GO:0016730GO-mf oxidoreductase activity, acting on iron-sulfur proteins as donors EnsemblGenomesN/AIEA
GO:0030385GO-mf ferredoxin:thioredoxin reductase activity EnsemblGenomesN/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
GO:0051536GO-mf iron-sulfur cluster binding EnsemblGenomesN/AIEA
GO:0051539GO-mf 4 iron, 4 sulfur cluster binding EnsemblGenomesN/AIEA
GO:0103012GO-mf ferredoxin-thioredoxin reductase activity EnsemblGenomesN/AIEA
PF02943PFAM Ferredoxin thioredoxin reductase catalytic beta chain JGI N/AIEA
GN7V-60871SoyCyc9-rxn ferredoxin:thioredoxin reductase Plant Metabolic Network ISS

Proteins Associated with Glyma.13g069100
LocusGene SymbolProtein Name
FTRC ferredoxin thioredoxin reductase precursor

Expression Patterns of Glyma.13g069100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.13g069100
ParalogEvidenceComments
Glyma.19g013800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.13g069100 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma13g04640 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.13g069100
>Glyma.13g069100.1 sequence-type=CDS polypeptide=Glyma.13g069100.1.p locus=Glyma.13g069100 ID=Glyma.13g069100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGACCACCCAAGCTTCCACCTTCGCCGTCGCCGTTCCCTCCGTCGCAACCCCTTTCCGCCGCCACCGGAATCCCTTCGTTGTTCGAGCCCAAGCGGAACCTTCAGATAAATCCGTTGAAATTATGAGGAAGTTCTCAGAGCAATACGCCCGTAAGTCAGGAACATACTTTTGTGTTGACAAGGGGGTCACTTCTGTTGTTATCAAGGGGTTGGCTGACCATAAAGATACGTTGGGTGCACCACTGTGCCCTTGCCGGCATTACGATGATAAAGCTGCTGAGGTTGCACAAGGATTTTGGAATTGCCCTTGTGTTCCCATGAGAGAGAGGAAGGAGTGCCACTGCATGCTATTTCTCACACCTGATAACGATTTTGCTGGCAATGAACAGACTATCACCTTGGATGAAATTAAAGAATCAACAGCCAACATGTAG
Predicted protein sequences of Glyma.13g069100
>Glyma.13g069100.1.p sequence-type=predicted peptide transcript=Glyma.13g069100.1 locus=Glyma.13g069100 ID=Glyma.13g069100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MTTQASTFAVAVPSVATPFRRHRNPFVVRAQAEPSDKSVEIMRKFSEQYARKSGTYFCVDKGVTSVVIKGLADHKDTLGAPLCPCRHYDDKAAEVAQGFWNCPCVPMRERKECHCMLFLTPDNDFAGNEQTITLDEIKESTANM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo