|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G04700.1 | AT | ferredoxin thioredoxin reductase catalytic beta chain family protein | JGI | N/A | IEA |
| GO:0022900 | GO-bp | electron transport chain | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | JGI | N/A | IEA |
| GO:0009507 | GO-cc | chloroplast | EnsemblGenomes | N/A | IEA |
| GO:0009536 | GO-cc | plastid | EnsemblGenomes | N/A | IEA |
| GO:0008937 | GO-mf | ferredoxin-NAD(P) reductase activity | JGI | N/A | IEA |
| GO:0009055 | GO-mf | electron transfer activity | EnsemblGenomes | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | EnsemblGenomes | N/A | IEA |
| GO:0016730 | GO-mf | oxidoreductase activity, acting on iron-sulfur proteins as donors | EnsemblGenomes | N/A | IEA |
| GO:0030385 | GO-mf | ferredoxin:thioredoxin reductase activity | EnsemblGenomes | N/A | IEA |
| GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
| GO:0051536 | GO-mf | iron-sulfur cluster binding | EnsemblGenomes | N/A | IEA |
| GO:0051539 | GO-mf | 4 iron, 4 sulfur cluster binding | EnsemblGenomes | N/A | IEA |
| GO:0103012 | GO-mf | ferredoxin-thioredoxin reductase activity | EnsemblGenomes | N/A | IEA |
| PF02943 | PFAM | Ferredoxin thioredoxin reductase catalytic beta chain | JGI | N/A | IEA |
| GN7V-60871 | SoyCyc9-rxn | ferredoxin:thioredoxin reductase | Plant Metabolic Network | ISS |
| Locus | Gene Symbol | Protein Name |
|---|---|---|
| FTRC | ferredoxin thioredoxin reductase precursor |
|
Glyma.13g069100 not represented in the dataset |
Glyma.13g069100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.19g013800 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma13g04640 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.13g069100.1 sequence-type=CDS polypeptide=Glyma.13g069100.1.p locus=Glyma.13g069100 ID=Glyma.13g069100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGACCACCCAAGCTTCCACCTTCGCCGTCGCCGTTCCCTCCGTCGCAACCCCTTTCCGCCGCCACCGGAATCCCTTCGTTGTTCGAGCCCAAGCGGAACCTTCAGATAAATCCGTTGAAATTATGAGGAAGTTCTCAGAGCAATACGCCCGTAAGTCAGGAACATACTTTTGTGTTGACAAGGGGGTCACTTCTGTTGTTATCAAGGGGTTGGCTGACCATAAAGATACGTTGGGTGCACCACTGTGCCCTTGCCGGCATTACGATGATAAAGCTGCTGAGGTTGCACAAGGATTTTGGAATTGCCCTTGTGTTCCCATGAGAGAGAGGAAGGAGTGCCACTGCATGCTATTTCTCACACCTGATAACGATTTTGCTGGCAATGAACAGACTATCACCTTGGATGAAATTAAAGAATCAACAGCCAACATGTAG
>Glyma.13g069100.1.p sequence-type=predicted peptide transcript=Glyma.13g069100.1 locus=Glyma.13g069100 ID=Glyma.13g069100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MTTQASTFAVAVPSVATPFRRHRNPFVVRAQAEPSDKSVEIMRKFSEQYARKSGTYFCVDKGVTSVVIKGLADHKDTLGAPLCPCRHYDDKAAEVAQGFWNCPCVPMRERKECHCMLFLTPDNDFAGNEQTITLDEIKESTANM*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||