SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.13g046200

Feature Type:gene_model
Chromosome:Gm13
Start:14043433
stop:14044927
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.13g046200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G38410.1AT Ribulose bisphosphate carboxylase (small chain) family protein JGI N/AIEA
GO:0009853GO-bp photorespiration EnsemblGenomesN/AIEA
GO:0015977GO-bp carbon fixation EnsemblGenomesN/AIEA
GO:0015979GO-bp photosynthesis EnsemblGenomesN/AIEA
GO:0019253GO-bp reductive pentose-phosphate cycle EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0009507GO-cc chloroplast EnsemblGenomesN/AIEA
GO:0009536GO-cc plastid EnsemblGenomesN/AIEA
GO:0004497GO-mf monooxygenase activity EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
GO:0016829GO-mf lyase activity EnsemblGenomesN/AIEA
GO:0016984GO-mf ribulose-bisphosphate carboxylase activity EnsemblGenomesN/AIEA
PF00101PFAM Ribulose bisphosphate carboxylase, small chain JGI N/AIEA
PF12338PFAM Ribulose-1,5-bisphosphate carboxylase small subunit JGI N/AIEA
CALVIN-PWYSoyCyc9 Calvin-Benson-Bassham cycle Plant Metabolic Network ISS
PHOTOALL-PWYSoyCyc9 oxygenic photosynthesis Plant Metabolic Network ISS
PWY-5723SoyCyc9 Rubisco shunt Plant Metabolic Network ISS
GN7V-41340SoyCyc9-rxn ribulose-bisphosphate carboxylase Plant Metabolic Network ISS

Proteins Associated with Glyma.13g046200
LocusGene SymbolProtein Name
RBCS-1 Ribulose bisphosphate carboxylase small chain 1, chloroplastic

Expression Patterns of Glyma.13g046200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.13g046200
ParalogEvidenceComments
Glyma.19g046600 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.13g046200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma13g07610 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.13g046200
>Glyma.13g046200.1 sequence-type=CDS polypeptide=Glyma.13g046200.1.p locus=Glyma.13g046200 ID=Glyma.13g046200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTTCCTCAATGATCTCCTCCCCAGCTGTTACCACCGTCAACCGTGCCGGTGCCGGCATGGTTGCTCCATTCACCGGCCTCAAATCCATGGCTGGCTTCCCCACGAGGAAGACCAACAATGACATTACCTCCATTGCTAGCAACGGTGGAAGAGTACAATGCATGCAGGTGTGGCCACCAATTGGCAAGAAGAAGTTCGAGACTCTTTCCTACTTGCCAGACCTCGATGATGCCCAATTGGCAAAGGAAGTCGAATACCTTCTAAGGAAAGGATGGATTCCTTGCTTGGAATTCGAGTTGGAGCACGGTTTCGTGTACCGTGAGCACAACAGGTCACCTGGATACTATGATGGACGCTACTGGACCATGTGGAAGCTGCCTATGTTTGGCTGCACTGATGCTTCTCAGGTGTTGAAGGAGCTTCAAGAGGCTAAGACTGCATACCCCAATGGCTTCATCCGTATCATTGGATTTGACAACGTTCGCCAAGTGCAGTGCATCAGCTTCATCGCCTACAAGCCCCCAGGCTTCTAA
Predicted protein sequences of Glyma.13g046200
>Glyma.13g046200.1.p sequence-type=predicted peptide transcript=Glyma.13g046200.1 locus=Glyma.13g046200 ID=Glyma.13g046200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASSMISSPAVTTVNRAGAGMVAPFTGLKSMAGFPTRKTNNDITSIASNGGRVQCMQVWPPIGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNGFIRIIGFDNVRQVQCISFIAYKPPGF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo