SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.13g034000

Feature Type:gene_model
Chromosome:Gm13
Start:10656555
stop:10657331
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.13g034000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24050.1AT NAD(P)-binding Rossmann-fold superfamily protein JGI N/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
PTHR24320Panther FAMILY NOT NAMED JGI N/AIEA
PTHR24320:SF98Panther JGI N/AIEA
PWY-5080SoyCyc9 very long chain fatty acid biosynthesis I Plant Metabolic Network ISS
PWY-7036SoyCyc9 very long chain fatty acid biosynthesis II Plant Metabolic Network ISS
GN7V-65989SoyCyc9-rxn Enzyme name not determined Plant Metabolic Network ISS

Expression Patterns of Glyma.13g034000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.13g034000 not represented in the dataset
Glyma.13g034000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.13g034000 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma13g09675 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.13g034000
>Glyma.13g034000.1 sequence-type=CDS polypeptide=Glyma.13g034000.1.p locus=Glyma.13g034000 ID=Glyma.13g034000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGGGCCAACGTCACTGTGAATTGTGTTCATCCTGGGATCGTTAGAACCAGACTCACTAGAGAGCGTGAGGGCTTACTCACAGATTTGGTGTTCTTTTTGGCTTCCAAGCTCTTGAAGACCATTCCTCAGGCAGCTGCTACGACATGTTATGTGGCCACTCATCCAAGGCTTTTCAATGTCTCCGACAAGTACTTTGCTGACTGTAACGAAATTTCAACCTCAAAATTGGGATCTAACTCAACTGAAGCTGCAAGGTTATGGGCTGCAAGTCTAAAATATAATTGCTTTAGATGCTAG
Predicted protein sequences of Glyma.13g034000
>Glyma.13g034000.1.p sequence-type=predicted peptide transcript=Glyma.13g034000.1 locus=Glyma.13g034000 ID=Glyma.13g034000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGANVTVNCVHPGIVRTRLTREREGLLTDLVFFLASKLLKTIPQAAATTCYVATHPRLFNVSDKYFADCNEISTSKLGSNSTEAARLWAASLKYNCFRC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo