|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G72280.1 | AT | endoplasmic reticulum oxidoreductins 1 | JGI | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | JGI | N/A | IEA |
| GO:0005783 | GO-cc | endoplasmic reticulum | EnsemblGenomes | N/A | IEA |
| GO:0005783 | GO-cc | endoplasmic reticulum | JGI | N/A | IEA |
| GO:0003756 | GO-mf | protein disulfide isomerase activity | EnsemblGenomes | N/A | IEA |
| GO:0003756 | GO-mf | protein disulfide isomerase activity | JGI | N/A | IEA |
| GO:0016671 | GO-mf | oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor | EnsemblGenomes | N/A | IEA |
| GO:0016671 | GO-mf | oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor | JGI | N/A | IEA |
| PTHR12613 | Panther | ERO1-RELATED | JGI | N/A | IEA |
| PF04137 | PFAM | Endoplasmic Reticulum Oxidoreductin 1 (ERO1) | JGI | N/A | IEA |
| GN7V-66986 | SoyCyc9-rxn | thiol oxidase | Plant Metabolic Network | ISS |
|
Glyma.13g028900 not represented in the dataset |
Glyma.13g028900 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma13g14716 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.13g028900.1 sequence-type=CDS polypeptide=Glyma.13g028900.1.p locus=Glyma.13g028900 ID=Glyma.13g028900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCAACATTTCTTTGTTACTTTGATGTATGACCGAGTCCTAAGATACCCTGATCGTGTTAGAAATTTGTATTTCACTTTTCTCTTTGTTCTACGAGCAGTAACCAAAGCTTCAAATTATCTGGAACAGGCAGAGTATGATACTTGTAACCCCAATGAGAACCTTACAACACAATCCTTGATAAAACAACTAATTTACAACCTCAAGCTTCAAGCTGCATGTCCAATTCCATTTGATGAAGCTAATTTGTGGAAAGGCCGAAGTGGACTTGAGCTAAAACAAAAAATTCAACAACAATTCAGAAACATCAGTGCATTGATGGATTGTGTAGGATGTGAGAAATGTCGATTATGGGGTATGCTTTAG
>Glyma.13g028900.1.p sequence-type=predicted peptide transcript=Glyma.13g028900.1 locus=Glyma.13g028900 ID=Glyma.13g028900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MQHFFVTLMYDRVLRYPDRVRNLYFTFLFVLRAVTKASNYLEQAEYDTCNPNENLTTQSLIKQLIYNLKLQAACPIPFDEANLWKGRSGLELKQKIQQQFRNISALMDCVGCEKCRLWGML*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||