SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.12g234500

Feature Type:gene_model
Chromosome:Gm12
Start:39394058
stop:39395461
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.12g234500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G14770.1AT Nodulin MtN3 family protein JGI N/AIEA
GO:0008643GO-bp carbohydrate transport EnsemblGenomesN/AIEA
GO:0034219GO-bp carbohydrate transmembrane transport EnsemblGenomesN/AIEA
GO:0005886GO-cc plasma membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane JGI N/AIEA
GO:0051119GO-mf sugar transmembrane transporter activity EnsemblGenomesN/AIEA
KOG1623 KOG Multitransmembrane protein JGI N/AIEA
PTHR10791Panther RAG1-ACTIVATING PROTEIN 1 JGI N/AIEA
PF03083PFAM Sugar efflux transporter for intercellular exchange JGI N/AIEA

Proteins Associated with Glyma.12g234500
LocusGene SymbolProtein Name
SWEET29 sugar efflux transporter SWEET29

Expression Patterns of Glyma.12g234500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.12g234500
ParalogEvidenceComments
Glyma.13g264400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.12g234500 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma12g36300 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.12g234500
>Glyma.12g234500.1 sequence-type=CDS polypeptide=Glyma.12g234500.1.p locus=Glyma.12g234500 ID=Glyma.12g234500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTCTCTCTTTGCTGCATTTTCCATTTGTAAAGTTGCCAAGGATGCAGCTGGAGTTGCAGGAAATGTGTTTGCTTTTGGGTTGTTTGTGTCTCCCATACCCACATTTAGGAGGATTATCAGAAATGGGTCAACAGAGATGTTCTCAGGGTTGCCATATATTTATTCCCTTCTGAACTGCTTGATCTGCATGTGGTATGGCACACCTCTGATATCTGCTGATAATTTGTTGGTTACAACTGTTAATTCAATTGGAGCAGTCTTTCAGTTTGTGTACACAATCATCTTCCTGATGTATGCTGAGAAAGCAAAGAAGGTGAGAATGGTTGGATTATTGCTGGCAGTTCTTGGCATGTTTGCAATCGTATTGGTTGGGAGCTTGCAGATAGATGACGTTATAATGCGTCGGTTCTTTGTGGGGTTCTTGAGCTGCGCGTCTCTCATTTCAATGTTTGCCTCTCCATTGTTTATAATTAAATTGGTCATTCAGACAAAGAGTGTTGAATTCATGCCGTTTTATCTCTCACTTTCCACCTTCCTAATGAGCACCTCTTTCTTACTTTATGGATTATTCAACGATGATGCTTTTATTTATGTGCCAAATGGGATAGGAACTATTTTGGGAATGATACAGTTGATATTATACTTCTACTTCGAGAGTAAATCTAGAGAGAGCTCCAGAGAACCTCTGATAGTATCATATGCATGA
Predicted protein sequences of Glyma.12g234500
>Glyma.12g234500.1.p sequence-type=predicted peptide transcript=Glyma.12g234500.1 locus=Glyma.12g234500 ID=Glyma.12g234500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSLFAAFSICKVAKDAAGVAGNVFAFGLFVSPIPTFRRIIRNGSTEMFSGLPYIYSLLNCLICMWYGTPLISADNLLVTTVNSIGAVFQFVYTIIFLMYAEKAKKVRMVGLLLAVLGMFAIVLVGSLQIDDVIMRRFFVGFLSCASLISMFASPLFIIKLVIQTKSVEFMPFYLSLSTFLMSTSFLLYGLFNDDAFIYVPNGIGTILGMIQLILYFYFESKSRESSREPLIVSYA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo