|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG00550.1 | AT | photosystem II reaction center protein J | JGI | N/A | IEA |
| GO:0015979 | GO-bp | photosynthesis | EnsemblGenomes | N/A | IEA |
| GO:0015979 | GO-bp | photosynthesis | JGI | N/A | IEA |
| GO:0009507 | GO-cc | chloroplast | EnsemblGenomes | N/A | IEA |
| GO:0009523 | GO-cc | photosystem II | EnsemblGenomes | N/A | IEA |
| GO:0009523 | GO-cc | photosystem II | JGI | N/A | IEA |
| GO:0009535 | GO-cc | chloroplast thylakoid membrane | EnsemblGenomes | N/A | IEA |
| GO:0009536 | GO-cc | plastid | EnsemblGenomes | N/A | IEA |
| GO:0009539 | GO-cc | photosystem II reaction center | EnsemblGenomes | N/A | IEA |
| GO:0009539 | GO-cc | photosystem II reaction center | JGI | N/A | IEA |
| GO:0009579 | GO-cc | thylakoid | EnsemblGenomes | N/A | IEA |
| GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
| GO:0016020 | GO-cc | membrane | JGI | N/A | IEA |
| GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
| PF01788 | PFAM | PsbJ | JGI | N/A | IEA |
|
Glyma.12g232800 not represented in the dataset |
Glyma.12g232800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma12g36141 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.12g232800.1 sequence-type=CDS polypeptide=Glyma.12g232800.1.p locus=Glyma.12g232800 ID=Glyma.12g232800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCCGATACTACTGGAAGGATTCCTCTTTGGATAATAGGTACTGTAACTGGTATTACTGTGATCGGTTTAATTGGTATTTTCTTTTATGGTTCATATTCCGGATTGGGCTCATCTCTGTAG
>Glyma.12g232800.1.p sequence-type=predicted peptide transcript=Glyma.12g232800.1 locus=Glyma.12g232800 ID=Glyma.12g232800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MADTTGRIPLWIIGTVTGITVIGLIGIFFYGSYSGLGSSL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||