|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G13720.1 | AT | Inosine triphosphate pyrophosphatase family protein | JGI | N/A | IEA |
| GO:0009143 | GO-bp | nucleoside triphosphate catabolic process | EnsemblGenomes | N/A | IEA |
| GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
| GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
| GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
| GO:0047429 | GO-mf | nucleoside-triphosphate diphosphatase activity | EnsemblGenomes | N/A | IEA |
| PWY-7184 | SoyCyc9 | pyrimidine deoxyribonucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-7187 | SoyCyc9 | pyrimidine deoxyribonucleotides de novo biosynthesis II | Plant Metabolic Network | ISS | |
| PWY-7206 | SoyCyc9 | pyrimidine deoxyribonucleotides dephosphorylation | Plant Metabolic Network | ISS | |
| PWY-7211 | SoyCyc9 | superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY0-166 | SoyCyc9 | superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) | Plant Metabolic Network | ISS | |
| GN7V-68436 | SoyCyc9-rxn | nucleoside triphosphate pyrophosphohydrolase | Plant Metabolic Network | ISS |
|
Glyma.12g173400 not represented in the dataset |
Glyma.12g173400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma12g29620 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.12g173400.1 sequence-type=CDS polypeptide=Glyma.12g173400.1.p locus=Glyma.12g173400 ID=Glyma.12g173400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCACTTCTTGGGCAATTCCATTCCTTTTCAGTCCCTCAAACTTGACTTGCCAGAGTTGCAAGGAGAACCTGAAGATATGTCCAAAGAGAAGGCTCGAATTGCTGCTCTTCAGGTGCATTGGCTTCCAGTGGATATAATTTTCTCTTTCACCCTTAACCATTCTGCAGGGCCTTACATGAAATTGGGGCCTTTGGGCATTGGGAGGCACAGACCCTCTAAGTGTGCTCTCTGTTCAGTGATTTGGGGAACATTCTCCTTAATGTTTTTTATCTATCCTGGCTTTCCCATGGGAAAAAGAACAGATACAAATTGGAACGTGAGAGATATTGTTTTTGTTTGCATCTAA
>Glyma.12g173400.1.p sequence-type=predicted peptide transcript=Glyma.12g173400.1 locus=Glyma.12g173400 ID=Glyma.12g173400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MHFLGNSIPFQSLKLDLPELQGEPEDMSKEKARIAALQVHWLPVDIIFSFTLNHSAGPYMKLGPLGIGRHRPSKCALCSVIWGTFSLMFFIYPGFPMGKRTDTNWNVRDIVFVCI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||