SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.12g161400

Feature Type:gene_model
Chromosome:Gm12
Start:30082259
stop:30084442
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.12g161400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54500.1AT flavodoxin-like quinone reductase 1 JGI N/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0005886GO-cc plasma membrane EnsemblGenomesN/AIEA
GO:0003955GO-mf NAD(P)H dehydrogenase (quinone) activity EnsemblGenomesN/AIEA
GO:0010181GO-mf FMN binding EnsemblGenomesN/AIEA
GO:0010181GO-mf FMN binding JGI N/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity JGI N/AIEA
KOG3135 KOG 1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein JGI N/AIEA
PF03358PFAM NADPH-dependent FMN reductase JGI N/AIEA
GN7V-42251SoyCyc9-rxn NAD(P)H dehydrogenase (quinone) Plant Metabolic Network ISS

Expression Patterns of Glyma.12g161400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.12g161400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma12g25950 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.12g161400
>Glyma.12g161400.1 sequence-type=CDS polypeptide=Glyma.12g161400.1.p locus=Glyma.12g161400 ID=Glyma.12g161400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTGTCCAAGTTTATATTGTGTATTACTCAATGTACAGGCATGTGGATAGACTAGCGGAAGAAATAAAGAAAGGAGTTGATTCTGTAGAAGGTGTTGAGGCCAAACTATGGCAGGTACCAGAGACATTGCCAGAAGAGGTGCTTGGCAAAATGAGAGCACCACCCAAGAGTGATGTGCCAATTATTACCCCCAATGAACTCTCTGAGGCTGATGGCTTTGTCTTTGGCTTCCCCACAAGATTTGGAATGATGGCAGCGCAGTTCAAAGCATTTCTGGATGCAACTGGAGGCTTATGGAAAACACAACAGCTTGCAGGCAAGCCTGCTGGAATCTTCTACAGCACTAGTTCCCAAGGTGGTGGACAAGAAACAACAGCGCTTACTGCTATAACTCAGCTGGTTCATCATGGAATGCTATTTGTTCCGATTGGATACACATTTGGTGCTGGAATGTTCGATATGGAGGAACTCAAAGGTGGAAGTCCATATGGTTCAGGAACTTATGCAGGTGATGGTTCAAGACAACCAACTAAGCTTGAGTTGGAGCAAGCATTCCACCAAGGCAAGTATATCGCCAGCATCACAAAGAAGCTCAAGGAAGCTGCATAA
Predicted protein sequences of Glyma.12g161400
>Glyma.12g161400.1.p sequence-type=predicted peptide transcript=Glyma.12g161400.1 locus=Glyma.12g161400 ID=Glyma.12g161400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAVQVYIVYYSMYRHVDRLAEEIKKGVDSVEGVEAKLWQVPETLPEEVLGKMRAPPKSDVPIITPNELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWKTQQLAGKPAGIFYSTSSQGGGQETTALTAITQLVHHGMLFVPIGYTFGAGMFDMEELKGGSPYGSGTYAGDGSRQPTKLELEQAFHQGKYIASITKKLKEAA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo