SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.12g160200

Feature Type:gene_model
Chromosome:Gm12
Start:28405739
stop:28406454
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.12g160200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G27190.1AT uridine kinase-like 2 JGI N/AIEA
GO:0006206GO-bp pyrimidine nucleobase metabolic process EnsemblGenomesN/AIEA
GO:0008152GO-bp metabolic process EnsemblGenomesN/AIEA
GO:0008152GO-bp metabolic process JGI N/AIEA
GO:0016310GO-bp phosphorylation EnsemblGenomesN/AIEA
GO:0043097GO-bp pyrimidine nucleoside salvage EnsemblGenomesN/AIEA
GO:0044206GO-bp UMP salvage EnsemblGenomesN/AIEA
GO:0005829GO-cc cytosol EnsemblGenomesN/AIEA
GO:0004849GO-mf uridine kinase activity EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding JGI N/AIEA
GO:0016301GO-mf kinase activity EnsemblGenomesN/AIEA
GO:0016301GO-mf kinase activity JGI N/AIEA
PTHR10285Panther URIDINE KINASE JGI N/AIEA
PTHR10285:SF6Panther URACIL PHOSPHORIBOSYLTRANSFERASE HOMOLOG JGI N/AIEA
PF00485PFAM Phosphoribulokinase / Uridine kinase family JGI N/AIEA
PWY-7183SoyCyc9 pyrimidine nucleobases salvage I Plant Metabolic Network ISS
PWY-7193SoyCyc9 pyrimidine ribonucleosides salvage I Plant Metabolic Network ISS
PWY-7196SoyCyc9 superpathway of pyrimidine ribonucleosides salvage Plant Metabolic Network ISS
PWY-7208SoyCyc9 superpathway of pyrimidine nucleobases salvage Plant Metabolic Network ISS
PWYQT-4445SoyCyc9 pyrimidine salvage pathway Plant Metabolic Network ISS
GN7V-64660SoyCyc9-rxn uridine kinase Plant Metabolic Network ISS

Expression Patterns of Glyma.12g160200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.12g160200 not represented in the dataset
Glyma.12g160200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.12g160200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma12g18983 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.12g160200
>Glyma.12g160200.1 sequence-type=CDS polypeptide=Glyma.12g160200.1.p locus=Glyma.12g160200 ID=Glyma.12g160200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCTGAAAGAAACGACGTCGATTGACTACGTAATGGAGGCTGCATCTAGGCCCCACTTCTCCACCCTGAGACTCGACGGTCGAGTCCTATCCTCCGCCACCGTCGCGTCCTCCACTCTCGATTCAAGCCTAACCCTCAATTCCCTTCCCAATCAACCCATTATCATAAGAGTTTCTGGAGGTACTGCCTTGGACAAAACCACCGTCTGCGATATGATCATTCAACAACTCCACGATCATTGCGTTGTCCTTGTAAATCAGGACTTGTTTTATCGCGGGTTGAATCCTGAAGAGTTGGAATGTGCTCACGAGTACAATTTCGACCACCCTGATGCTTTTGACTCGAAGCAATTGTTAGAGTGCACGAGGAAGCTCATTAGTGGTCAAGGCGTGCATGTTCCTATATATGACTTCAAGAATCACCAAGGCTCTTCTGATAATTTTCGCTAG
Predicted protein sequences of Glyma.12g160200
>Glyma.12g160200.1.p sequence-type=predicted peptide transcript=Glyma.12g160200.1 locus=Glyma.12g160200 ID=Glyma.12g160200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLKETTSIDYVMEAASRPHFSTLRLDGRVLSSATVASSTLDSSLTLNSLPNQPIIIRVSGGTALDKTTVCDMIIQQLHDHCVVLVNQDLFYRGLNPEELECAHEYNFDHPDAFDSKQLLECTRKLISGQGVHVPIYDFKNHQGSSDNFR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo