SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.12g160100

Feature Type:gene_model
Chromosome:Gm12
Start:28382310
stop:28382788
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.12g160100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13180.1AT NAC domain containing protein 83 JGI N/AIEA
GO:0006351GO-bp transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding JGI N/AIEA
PF02365PFAM No apical meristem (NAM) protein JGI N/AIEA

Proteins Associated with Glyma.12g160100
LocusGene SymbolProtein Name
NAC173 NAC domain-containing protein 173
NAC173 NAC Transcription Factor gene 173

Expression Patterns of Glyma.12g160100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.12g160100 not represented in the dataset
Glyma.12g160100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.



Coding sequences of Glyma.12g160100
>Glyma.12g160100.1 sequence-type=CDS polypeptide=Glyma.12g160100.1.p locus=Glyma.12g160100 ID=Glyma.12g160100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAGCTGGTTCTGCAATACTTGAAGCGCAAGGTCTTCTCCTGCCCTTTGCCAGCCTCTATCATTCCTGAGCTTCATGTTTGCAAGTCTGATCCTTGGGATTTGCCAGGTGATTTGGAGCAAGAGAGATACTTCTTTAGCACCAAAGTGGCCAAATATCCCAACGGAAATCGCTCCAACAGAGCCACAAATTCGGGTTATTGGAAGGCAACTGGTTTGGACAAACAAATTGTTACTTCAAAAGGGAACAACCAAGTTTTCGAAATGAATAAGACACTTGTTTTCTGCAGAGGCAAGCCTCCTTATGGATCCAGAACTGATTGGATCATGCACGAGTATCGCCTCATCCTTAACGGCTCTCAGTCTAAGGTGAGGCCAAACAAACTTCTACTATTTATGTAA
Predicted protein sequences of Glyma.12g160100
>Glyma.12g160100.1.p sequence-type=predicted peptide transcript=Glyma.12g160100.1 locus=Glyma.12g160100 ID=Glyma.12g160100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MELVLQYLKRKVFSCPLPASIIPELHVCKSDPWDLPGDLEQERYFFSTKVAKYPNGNRSNRATNSGYWKATGLDKQIVTSKGNNQVFEMNKTLVFCRGKPPYGSRTDWIMHEYRLILNGSQSKVRPNKLLLFM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo