SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.12g132600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.12g132600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.12g132600

Feature Type:gene_model
Chromosome:Gm12
Start:14995275
stop:14999309
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14480.1AT Protein kinase superfamily protein JGI N/AIEA
GO:0006468GO-bp protein phosphorylation EnsemblGenomesN/AIEA
GO:0006468GO-bp protein phosphorylation JGI N/AIEA
GO:0007346GO-bp regulation of mitotic cell cycle EnsemblGenomesN/AIEA
GO:0023014GO-bp signal transduction by protein phosphorylation EnsemblGenomesN/AIEA
GO:0031098GO-bp stress-activated protein kinase signaling cascade EnsemblGenomesN/AIEA
GO:0032147GO-bp activation of protein kinase activity EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0004672GO-mf protein kinase activity EnsemblGenomesN/AIEA
GO:0004672GO-mf protein kinase activity JGI N/AIEA
GO:0004674GO-mf protein serine/threonine kinase activity EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding JGI N/AIEA
PTHR24361Panther MITOGEN-ACTIVATED KINASE KINASE KINASE JGI N/AIEA
PTHR24361:SF72Panther JGI N/AIEA
PF00069PFAM Protein kinase domain JGI N/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.12g132600 not represented in the dataset

Glyma.12g132600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma12g15890 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.12g132600.1 sequence-type=CDS polypeptide=Glyma.12g132600.1.p locus=Glyma.12g132600 ID=Glyma.12g132600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAACTCTGCCGCCGTCGCAATCAAATCCATCAAACTCAACCGCTCCCGGCCTGACTTAGACGATGTCCGTTGCGAGGCCAAAACCCCATCCCTCCTTTCCTACCCCAACATCCTCAAAGCACATTGTTCCTTCACAGTGGATCGCTGCCTCTGGGTGGTGATGTCGTTCATGGCCGCAGGATCACTTCAATCCATCATTTATCATTCCCACCCCAACGGCTTAATGGAGCCCTACATCACCGTGGTTCTCAGAGACACGCTCAACGCGCTCTCCTACCTCCACTGCCAGCATCTCCATAGAGACATTAAAGTCGGTAACATCCTCATTTACACCAATGGGCAAGTGAAGCTTGCTGATTTCGGTGTCTCCGCTTCCATATACGAGTCCACCACCACCACCACCACGTCTTCTTCTTCGTCTCTGAAGTTCACTAATGTTGTCGGCACGCCCTATTGGATGGCTCCTGAGGTGATTCACTCACACACAGGTTACAGTTTCGAGGCTGATATATGGTCTTTTGGGATAACCGCGTTGGAGCTTGCGCATGGAAGGCCTCCTCTCTCGCACCTTCCACCTTCCAAGTTCATGATGCTCAAGATCACCAAGAGGTTTCCTTTCTCCGATGATTTCGATGACAAGGAAAATATGATAACACAATTAAAGAATGCACAGAGGCATTAG

>Glyma.12g132600.1.p sequence-type=predicted peptide transcript=Glyma.12g132600.1 locus=Glyma.12g132600 ID=Glyma.12g132600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MNSAAVAIKSIKLNRSRPDLDDVRCEAKTPSLLSYPNILKAHCSFTVDRCLWVVMSFMAAGSLQSIIYHSHPNGLMEPYITVVLRDTLNALSYLHCQHLHRDIKVGNILIYTNGQVKLADFGVSASIYESTTTTTTSSSSSLKFTNVVGTPYWMAPEVIHSHTGYSFEADIWSFGITALELAHGRPPLSHLPPSKFMMLKITKRFPFSDDFDDKENMITQLKNAQRH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo