SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.12g132100

Feature Type:gene_model
Chromosome:Gm12
Start:14924076
stop:14925623
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G28490.1AT syntaxin of plants 61 JGI N/AIEA
GO:0006886GO-bp intracellular protein transport EnsemblGenomesN/AIEA
GO:0006887GO-bp exocytosis EnsemblGenomesN/AIEA
GO:0006906GO-bp vesicle fusion EnsemblGenomesN/AIEA
GO:0048278GO-bp vesicle docking EnsemblGenomesN/AIEA
GO:0005886GO-cc plasma membrane EnsemblGenomesN/AIEA
GO:0012505GO-cc endomembrane system EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0031201GO-cc SNARE complex EnsemblGenomesN/AIEA
GO:0000149GO-mf SNARE binding EnsemblGenomesN/AIEA
GO:0005484GO-mf SNAP receptor activity EnsemblGenomesN/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma12g15840 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.12g132100.1 sequence-type=CDS polypeptide=Glyma.12g132100.1.p locus=Glyma.12g132100 ID=Glyma.12g132100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCAGAAACAGAGCAGGAAGAAGGAAAGAATGAAAGCAGTGGCAGACCAAAACGTGGAAGCAACAGACCAAGAAGCAGAATCCACCAATTCTGCAGAGCTGATTACCGTTAGATGCTGTCCCCTTCGGTTTTGCAATTTCACAATTCCTCCAAGACAAATAATGCCAAAATCTGTTAGGATTATACCTAGGGTTTGCAATAGAAATGTCTATAAATACAAAGAAAGTGTAATTCTAATGGATATGAATAATACAAGCTCGTTTCTAAAAAGAAAATGGGGGAGAATAAAGACTGGCAGTGCTAAAGAGTTTTGGGAAAATAATCAATCTCTGGTTTCTATTTTATTTTTGTCTTTTATTTTATCTATTGGTCCTGATAGGAGACAAGATGAGGAGTTGGATGAGCTTAGTTTAAGTGTACAAATAATAGGAGGTGTTGGACTTTCTATACATGAAGAGCTCCTTACTTTGAAGTGTGTCTCATTGTTTATGATATCAGAAAAAAGTGCCAATGGTCATGTAGAAGGCAGTGCAAATGACCAGATCATGATGATATTGGGTTTGTTGGCACTGTTCATTTTCCTCTTTATCTTGGTTTTCTTCACCTAG

>Glyma.12g132100.1.p sequence-type=predicted peptide transcript=Glyma.12g132100.1 locus=Glyma.12g132100 ID=Glyma.12g132100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MQKQSRKKERMKAVADQNVEATDQEAESTNSAELITVRCCPLRFCNFTIPPRQIMPKSVRIIPRVCNRNVYKYKESVILMDMNNTSSFLKRKWGRIKTGSAKEFWENNQSLVSILFLSFILSIGPDRRQDEELDELSLSVQIIGGVGLSIHEELLTLKCVSLFMISEKSANGHVEGSANDQIMMILGLLALFIFLFILVFFT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo