Report for Sequence Feature Glyma.12g128100
Feature Type: gene_model
Chromosome: Gm12
Start: 14053897
stop: 14057570
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.12g128100
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G42610.1 AT
Protein of unknown function (DUF640)
JGI N/A IEA
GO:0009299 GO-bp
mRNA transcription
EnsemblGenomes N/A IEA
GO:0009416 GO-bp
response to light stimulus
EnsemblGenomes N/A IEA
GO:0005634 GO-cc
nucleus
EnsemblGenomes N/A IEA
PF04852 PFAM
Protein of unknown function (DUF640)
JGI N/A IEA
Expression Patterns of Glyma.12g128100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.12g128100
Paralog Evidence Comments
Glyma.06g277400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.12g128100 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma12g15250 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.12g128100
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.12g128100.1 sequence-type=CDS polypeptide=Glyma.12g128100.1.p locus=Glyma.12g128100 ID=Glyma.12g128100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTCCAGCAGTGGCAGTCACGGTACAGAAGGCTCATCAAGCAACATTCCCATAGAGTATCAGCAGCAGCAGCAGAGTCCAGTGACACTTAGCCGCTATGAGTCACAGAAGAGAAGGGACTGGAACACTTTTGGACAATACTTGAAGAACCAGAGACCCCCGGTACCTCTCTCTCAGTGCAATTGCAACCATGTGCTCGATTTCCTCCGTTATCTGGACCAGTTTGGCAAGACCAAGGTCCACCTTCAAGGGTGCATGTTCTATGGCCAGCCCGAACCCCCTGCGCCCTGCGCCTGCCCTCTTAGGCAGGCCTGGGGGAGTCTCGACGCCCTCATAGGCAGGCTCAGAGCTGCCTATGAGGAAAACGGAGGCTCCCCAGAGACTAACCCTTTTGCCAGCGGCTCAATCCGCGTCTACCTTAGGGAGGTCAGGGAGTGCCAGGCTAAGGCTAGAGGTATAGCTTACAAGAAGAAAAAGAAGACCACAAAGGAAAATGCTGAAGAATCATCAAACTCTTCCATCCACTTCTCTTGA
Predicted protein sequences of Glyma.12g128100
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.12g128100.1.p sequence-type=predicted peptide transcript=Glyma.12g128100.1 locus=Glyma.12g128100 ID=Glyma.12g128100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSSSGSHGTEGSSSNIPIEYQQQQQSPVTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAKARGIAYKKKKKTTKENAEESSNSSIHFS*