Report for Sequence Feature Glyma.12g073400
| Feature Type: | gene_model |
| Chromosome: | Gm12 |
| Start: | 5455008 |
| stop: | 5455214 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.12g073400
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| PTHR37721 | PantherFam |
OS05G0464200 PROTEIN |
JGI | N/A | IEA |
| PTHR37721:SF1 | PantherFam |
OS05G0464200 PROTEIN |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.12g073400 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma12g07815 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.12g073400
>Glyma.12g073400.1 sequence-type=CDS polypeptide=Glyma.12g073400.1.p locus=Glyma.12g073400 id=Glyma.12g073400.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGCAACAAATAATTCCACAGTTCACAACAAGAAAACAAGTTTTCCACCAAAAAGGGGCCAAATTAAAGCTCAGATATTTAGCAACTTGGTCAAAATTGTTGCCTCTAAATTCTCAAAGGACGAAAAAGACGACGATGATAAAAACGGTGGTGACTCTGCTATATCGACCCCACCACCAAGTGCTTACAGCTCCGATGGAGTCTAG
Predicted protein sequences of Glyma.12g073400
>Glyma.12g073400.1.p sequence-type=predicted peptide transcript=Glyma.12g073400.1 locus=Glyma.12g073400 id=Glyma.12g073400.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MATNNSTVHNKKTSFPPKRGQIKAQIFSNLVKIVASKFSKDEKDDDDKNGGDSAISTPPPSAYSSDGV*