|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G54420.1 | AT | homolog of carrot EP3-3 chitinase | JGI | N/A | IEA |
| GO:0006032 | GO-bp | chitin catabolic process | EnsemblGenomes | N/A | IEA |
| GO:0006032 | GO-bp | chitin catabolic process | JGI | N/A | IEA |
| GO:0016998 | GO-bp | cell wall macromolecule catabolic process | EnsemblGenomes | N/A | IEA |
| GO:0016998 | GO-bp | cell wall macromolecule catabolic process | JGI | N/A | IEA |
| GO:0004568 | GO-mf | chitinase activity | EnsemblGenomes | N/A | IEA |
| GO:0004568 | GO-mf | chitinase activity | JGI | N/A | IEA |
| PTHR22595 | Panther | CHITINASE-RELATED | JGI | N/A | IEA |
| PTHR22595:SF7 | Panther | JGI | N/A | IEA | |
| PF00182 | PFAM | Chitinase class I | JGI | N/A | IEA |
| PWY-6902 | SoyCyc9 | chitin degradation II (Vibrio) | Plant Metabolic Network | ISS | |
| GN7V-42962 | SoyCyc9-rxn | chitinase | Plant Metabolic Network | ISS |
|
Glyma.12g049100 not represented in the dataset |
Glyma.12g049100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma12g05301 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.12g049100.1 sequence-type=CDS polypeptide=Glyma.12g049100.1.p locus=Glyma.12g049100 ID=Glyma.12g049100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAGCAAGTTACTACACATTCGTGTTGCTGGGTTTGTGGCAACCTTTGTCATCATGGTGATGACGATGGTGCCCATAAACGTGAGTGCTCAAAACATTGGTGATGACATCGTCACACAAGAATTCTTCAACAGCATAATCGATCAGGCTGATGCTAGTTGTGCAGGGAAGAACTTCTACTCACGAGATGTTTTCCTTAATGCTCACAATTCCTACAATGAGTTTGGTAGGCTTGGAAACCAGGATGACTCCAAGCGTGAGGTTGCAGCTTCTTTTGCCCATTTCACCCATGAAACTGGACATTTTTGCTACATAGAAGAGATTAATGGAGCAGCAGGGGACTAG
>Glyma.12g049100.1.p sequence-type=predicted peptide transcript=Glyma.12g049100.1 locus=Glyma.12g049100 ID=Glyma.12g049100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MSKLLHIRVAGFVATFVIMVMTMVPINVSAQNIGDDIVTQEFFNSIIDQADASCAGKNFYSRDVFLNAHNSYNEFGRLGNQDDSKREVAASFAHFTHETGHFCYIEEINGAAGD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||