Glyma.11g192100

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.11g192100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.11g192100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.11g192100

Feature Type:	gene_model
Chromosome:	Gm11
Start:	26538147
stop:	26539588
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.11g192100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G27970.1	AT	CDK-subunit 2	JGI	N/A	IEA
GO:0007049	GO-bp	cell cycle	EnsemblGenomes	N/A	IEA
GO:0007049	GO-bp	cell cycle	JGI	N/A	IEA
GO:0007346	GO-bp	regulation of mitotic cell cycle	EnsemblGenomes	N/A	IEA
GO:0016310	GO-bp	phosphorylation	EnsemblGenomes	N/A	IEA
GO:0045737	GO-bp	positive regulation of cyclin-dependent protein serine/threonine kinase activity	EnsemblGenomes	N/A	IEA
GO:0045893	GO-bp	positive regulation of transcription, DNA-templated	EnsemblGenomes	N/A	IEA
GO:0051301	GO-bp	cell division	EnsemblGenomes	N/A	IEA
GO:0000307	GO-cc	cyclin-dependent protein kinase holoenzyme complex	EnsemblGenomes	N/A	IEA
GO:0019005	GO-cc	SCF ubiquitin ligase complex	EnsemblGenomes	N/A	IEA
GO:0016301	GO-mf	kinase activity	EnsemblGenomes	N/A	IEA
GO:0016538	GO-mf	cyclin-dependent protein serine/threonine kinase regulator activity	EnsemblGenomes	N/A	IEA
GO:0016538	GO-mf	cyclin-dependent protein serine/threonine kinase regulator activity	JGI	N/A	IEA
GO:0019901	GO-mf	protein kinase binding	EnsemblGenomes	N/A	IEA
GO:0042393	GO-mf	histone binding	EnsemblGenomes	N/A	IEA
GO:0043130	GO-mf	ubiquitin binding	EnsemblGenomes	N/A	IEA
GO:0061575	GO-mf	cyclin-dependent protein serine/threonine kinase activator activity	EnsemblGenomes	N/A	IEA
KOG3484	KOG	Cyclin-dependent protein kinase CDC28, regulatory subunit CKS1, and related proteins	JGI	N/A	IEA
PTHR23415	Panther	CYCLIN-DEPENDENT KINASES REGULATORY SUBUNIT/60S RIBOSOME SUBUNIT BIOGENESIS PROTEIN NIP7	JGI	N/A	IEA
PTHR23415:SF10	Panther		JGI	N/A	IEA
PF01111	PFAM	Cyclin-dependent kinase regulatory subunit	JGI	N/A	IEA

Expression Patterns of Glyma.11g192100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.11g192100 not represented in the dataset	Glyma.11g192100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.11g192100

Paralog	Evidence	Comments
Glyma.12g082300	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.11g192100 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma11g19780	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.11g192100

Limit To All Plant Sequences

>Glyma.11g192100.1 sequence-type=CDS polypeptide=Glyma.11g192100.1.p locus=Glyma.11g192100 ID=Glyma.11g192100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGTCAGATCCAGTACTCCGAGAAGTACTTCGATGACACTTACGAATATAGACATGTGGTTCTTCCTCCTGAAGTCGCAAAACTGCTTCCCAAGAATCGTCTTCTCTCCGAAAATGAGTGGCGGGCAATTGGGGTTCAGCAGAGCCGTGGCTGGGTTCATTATGCAATTCATCGCCCTGAGCCACACATAATGCTCTTCAGGAGGCCTTTGAATTATCAGCAGCAGCAGGAAAACCAGGCCCAGCAAAGCATGCTTGTCAAATGA

Predicted protein sequences of Glyma.11g192100

Limit To All Plant Sequences

>Glyma.11g192100.1.p sequence-type=predicted peptide transcript=Glyma.11g192100.1 locus=Glyma.11g192100 ID=Glyma.11g192100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQSMLVK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain