Report for Sequence Feature Glyma.11g161000
Feature Type: gene_model
Chromosome: Gm11
Start: 14851005
stop: 14851751
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.11g161000
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G58375.1 AT
Methyltransferase-related protein
JGI N/A IEA
Expression Patterns of Glyma.11g161000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.11g161000
Paralog Evidence Comments
Glyma.18g054800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.11g161000 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma11g30080 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.11g161000
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.11g161000.1 sequence-type=CDS polypeptide=Glyma.11g161000.1.p locus=Glyma.11g161000 ID=Glyma.11g161000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTGTCCTCTGCGATTCATTCTGATATTCTTGTCCGCAACCCTCGCCGGTTTTTTCGTTCTCAGAAACCTCAGATCTCAGCCTCAAATTGAAGAAGGCGACGCTGTTGTTCCTCCCAACCCTAAAATCTCAGACTCCTCCGACGCTTCCTCAAATGTAACTTCCAAGCTTCGCGCTGTGGTAGAGTCTGGGTTCTGGACCTTCGTGGATATGGCTAGTGGCCGTTATCTTTGGAGGCATTTGGTCTGTAATTCTTCCAAGAGATCGTGA
Predicted protein sequences of Glyma.11g161000
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.11g161000.1.p sequence-type=predicted peptide transcript=Glyma.11g161000.1 locus=Glyma.11g161000 ID=Glyma.11g161000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MCPLRFILIFLSATLAGFFVLRNLRSQPQIEEGDAVVPPNPKISDSSDASSNVTSKLRAVVESGFWTFVDMASGRYLWRHLVCNSSKRS*