|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G47550.1 | AT | Cystatin/monellin superfamily protein | JGI | N/A | IEA |
| GO:0010466 | GO-bp | negative regulation of peptidase activity | EnsemblGenomes | N/A | IEA |
| GO:2000117 | GO-bp | negative regulation of cysteine-type endopeptidase activity | EnsemblGenomes | N/A | IEA |
| GO:0002020 | GO-mf | protease binding | EnsemblGenomes | N/A | IEA |
| GO:0004869 | GO-mf | cysteine-type endopeptidase inhibitor activity | EnsemblGenomes | N/A | IEA |
| GO:0004869 | GO-mf | cysteine-type endopeptidase inhibitor activity | JGI | N/A | IEA |
| GO:0030414 | GO-mf | peptidase inhibitor activity | EnsemblGenomes | N/A | IEA |
| PTHR11413 | Panther | CYSTATIN FAMILY MEMBER | JGI | N/A | IEA |
| PTHR11413:SF28 | Panther | JGI | N/A | IEA | |
| PF00031 | PFAM | Cystatin domain | JGI | N/A | IEA |
|
Glyma.11g064200 not represented in the dataset |
Glyma.11g064200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma11g06850 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.11g064200.1 sequence-type=CDS polypeptide=Glyma.11g064200.1.p locus=Glyma.11g064200 ID=Glyma.11g064200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAGACACCACTGTCTCCTTCTCCTCTCCCTCGTCTTGGTCTCCTACGCTGCCCGGCGGTCGGAATCTGCGCTGGGCGGCTGGAGCCCCATCAAGGACGTGAACGACAGCCACGTGGCGGAGATCGCGAACTACGCGGTGAGCGAGTACGACAAGCGTTATGGGGCAAAGCTGACGCTGGTCAAGGTATCAAAGGGCGAGACTCAGGTCGTGGCCGGCACCAACTACCGCCTGGTCCTCAAGGTCAAGAATGGATCCACCACGGCCAGTTACCAAGCCACCGTGCTGGAGAAGCCTTGGCTCCATTTCAGGAATCTCACTTCCTTCAAACCCCTTCGTTCTTAG
>Glyma.11g064200.1.p sequence-type=predicted peptide transcript=Glyma.11g064200.1 locus=Glyma.11g064200 ID=Glyma.11g064200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MRHHCLLLLSLVLVSYAARRSESALGGWSPIKDVNDSHVAEIANYAVSEYDKRYGAKLTLVKVSKGETQVVAGTNYRLVLKVKNGSTTASYQATVLEKPWLHFRNLTSFKPLRS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||