Glyma.11g031600

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.11g031600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.11g031600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.11g031600

Feature Type:	gene_model
Chromosome:	Gm11
Start:	2319561
stop:	2320485
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.11g031600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G17260.1	AT	Lactate/malate dehydrogenase family protein	JGI	N/A	IEA
GO:0005975	GO-bp	carbohydrate metabolic process	EnsemblGenomes	N/A	IEA
GO:0055114	GO-bp	oxidation-reduction process	EnsemblGenomes	N/A	IEA
GO:0055114	GO-bp	oxidation-reduction process	JGI	N/A	IEA
GO:0003824	GO-mf	catalytic activity	EnsemblGenomes	N/A	IEA
GO:0004459	GO-mf	L-lactate dehydrogenase activity	EnsemblGenomes	N/A	IEA
GO:0016491	GO-mf	oxidoreductase activity	EnsemblGenomes	N/A	IEA
GO:0016491	GO-mf	oxidoreductase activity	JGI	N/A	IEA
GO:0016616	GO-mf	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	EnsemblGenomes	N/A	IEA
GO:0016616	GO-mf	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	JGI	N/A	IEA
KOG1495	KOG	Lactate dehydrogenase	JGI	N/A	IEA
PTHR11540	Panther	MALATE AND LACTATE DEHYDROGENASE	JGI	N/A	IEA
PTHR11540:SF3	Panther	SUBFAMILY NOT NAMED	JGI	N/A	IEA
PF00056	PFAM	lactate/malate dehydrogenase, NAD binding domain	JGI	N/A	IEA
PF02866	PFAM	lactate/malate dehydrogenase, alpha/beta C-terminal domain	JGI	N/A	IEA
PWY-5481	SoyCyc9	pyruvate fermentation to lactate	Plant Metabolic Network		ISS
PWY-7345	SoyCyc9	superpathway of anaerobic sucrose degradation	Plant Metabolic Network		ISS
GN7V-56438	SoyCyc9-rxn	L-lactate dehydrogenase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.11g031600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.11g031600 not represented in the dataset	Glyma.11g031600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.11g031600

Paralog	Evidence	Comments
Glyma.01g210400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.11g031600 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma11g03441	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.11g031600

Limit To All Plant Sequences

>Glyma.11g031600.1 sequence-type=CDS polypeptide=Glyma.11g031600.1.p locus=Glyma.11g031600 ID=Glyma.11g031600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCACAAGAGGAGTTCAGGTTCAGCATTGGGCCCAGGAGGCTTGGACCTAACTCAAGCCTTGTTCAAGTCCATCATGAACGCTGCACCTTCTTCTCCCACCAAGGACCACAACAAAATCTCCGTTGTTGGGGCAGGCAACGTGGGAATGGCCATAGCCCAAACCATCTCACTCAGGATCTCACCGACGACGATGAGATTCCTGACAAACACCACGGTGAGATGCTGGACCTCCAGCACGCCGCGGCCTTCCTCCCCGGCCATCTCCACACTCTTTGAGAAAATCATACCTCCTTTGGTCCGTTACTCCCCAGACACCATTCTTCTCATCGTTTCAAATCCCGTGGACGTGCTCACTTACGTGGCATGGAAGCTTTCGGGGTTCCCTTCAAACCACGTCATTGGCTATGGCACTAACTTGGACTCTTCCCGTTTTCGTTTCCTCATTGCTGATCATCTTGATGTCAACGCTCAAGATGTCCAGGCTTTTATAGTGGGGGAACATGGTGACAGCTCAGTGGGTTTTTATGGCATTGATGGTGGGGAAGTGTTCCTTAGCTTGCCTGCACAACTCGGAAGAGGAGGGGTTTTGGGTATAACCAATGTGCACTTGACTGAAGAAGAGACACAGAGGCTTAGGGACTCAGCTAAGACAATCCTCCGAGTGCAGAATCAGTTGGTTATTTGA

Predicted protein sequences of Glyma.11g031600

Limit To All Plant Sequences

>Glyma.11g031600.1.p sequence-type=predicted peptide transcript=Glyma.11g031600.1 locus=Glyma.11g031600 ID=Glyma.11g031600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MHKRSSGSALGPGGLDLTQALFKSIMNAAPSSPTKDHNKISVVGAGNVGMAIAQTISLRISPTTMRFLTNTTVRCWTSSTPRPSSPAISTLFEKIIPPLVRYSPDTILLIVSNPVDVLTYVAWKLSGFPSNHVIGYGTNLDSSRFRFLIADHLDVNAQDVQAFIVGEHGDSSVGFYGIDGGEVFLSLPAQLGRGGVLGITNVHLTEEETQRLRDSAKTILRVQNQLVI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain